SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 525897.Dbac_1602 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  525897.Dbac_1602
Domain Number 1 Region: 22-143,185-241
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.93e-25
Family Clp protease, ClpP subunit 0.057
Further Details:      
 
Domain Number 2 Region: 414-482
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000366
Family NfeD domain-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 525897.Dbac_1602
Sequence length 489
Comment (Desulfomicrobium baculatum DSM 4028)
Sequence
MSIYRSSNSFRILGVLAALILAVLAGFVFAQEADTGRRGYVLTVDDAIGPATRDHIVRNI
TRAEKEGAEVVVLRLNTPGGLDASMRDIIRKILASEVPVVTWVAPAGSRAASAGTYIMYA
SHIAAMAPATNLGSATPVQIGGGESDKSPSSWERAREAMEKMRDGDEGANATEQPENLPE
EPENLPDDAMGRKVVNDAVAYIKGLAERHARNAEWAERAVREAVSLTASEALEQRVVDVV
AANLPELLEAIDGREVRMENGTRTLQTANLATVEIETDWRTELLAIITNPTLAYMLLMVG
IYGLILEGYNPGAMVPGVIGGICLLLALYAFQILPVNFAGLALILLGMALIGVELFIPAF
GILGIGGIVAVVAGSVILFEGDMPEFRINTYAIVGMGAGSALLFGGIVWVAARTLRKPRL
SSREAMVGLEAEAIQDFIDGLGRVHLQGENWSARSGHPIRQGDKVRVIAMEEEGLVLSVT
KAPTDNDKH
Download sequence
Identical sequences C7LUG0
525897.Dbac_1602 WP_015773786.1.63071 gi|256829383|ref|YP_003158111.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]