SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 525898.Sdel_1081 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  525898.Sdel_1081
Domain Number 1 Region: 2-180
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 8.76e-36
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 525898.Sdel_1081
Sequence length 185
Comment (Sulfurospirillum deleyianum DSM 6946)
Sequence
MRRQLRFVGVGGQGVILAGEILAVAKIKQGGYGVKASTYTSQVRGGPTKVDILLDESEIL
FPYANEGEIEFMIATAQVSFNQFKEGVKEGGIIVVEPNLVKPSEEDRKKWRIIEIPLITI
AKEEVGNVITQSVVALSITVEMTQVLPHELVREVMLSKVPEKVHAANNKAYELGVKYAKE
ALAKL
Download sequence
Identical sequences D1B1Y5
gi|268679709|ref|YP_003304140.1| 525898.Sdel_1081 WP_012856863.1.51747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]