SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 525903.Taci_0585 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  525903.Taci_0585
Domain Number 1 Region: 2-179
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.09e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 525903.Taci_0585
Sequence length 185
Comment (Thermanaerovibrio acidaminovorans DSM 6589)
Sequence
MNTRMIFAGFGGQGVMLMGQIISYAGMLEGKHVTWMPSYGPEMRGGTANCTVVISDQEVA
SPVTNDAEVVVAMNIPSLVKFEPAVTPNGCLLINQSVIDREPQRTDLVSVKVPCNEIAEK
LGNLKVANMVMLGAVAGATGVVSKESIVKALEKKLSAGGKAALIEVNKNAIERGFETAKA
AVASK
Download sequence
Identical sequences D1B968
525903.Taci_0585 YP_003317103.1.71145 gi|269792199|ref|YP_003317103.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]