SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 525903.Taci_0696 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  525903.Taci_0696
Domain Number 1 Region: 24-90
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000222
Family NfeD domain-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 525903.Taci_0696
Sequence length 105
Comment (Thermanaerovibrio acidaminovorans DSM 6589)
Sequence
MDYPVEVWLGFLALGVVVVVLSAKALRQKPSFGKEGMEGSSALALTDLSPRGTVFCHGEI
WKARSVGGSIPKGSQVVVDRVEGLTLVVRPDDEKDGKTGGGADVV
Download sequence
Identical sequences D1B9H9
YP_003317214.1.71145 gi|269792310|ref|YP_003317214.1| 525903.Taci_0696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]