SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 525909.Afer_1571 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  525909.Afer_1571
Domain Number 1 Region: 91-146
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000366
Family NfeD domain-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 525909.Afer_1571
Sequence length 159
Comment (Acidimicrobium ferrooxidans DSM 10331)
Sequence
MLFVMIAFVAAAALIAVAIHFGPHGSVVSGVIGLVLGLVIAWSAQAAISTVGAWALGAGV
VVVGLALAGIGLRGVRGLNTRAAIAAPSPLARLLGEEAVVERDLSPIGAIHVHGESWTAT
TETGESVPAGTHVFITRVDGLRVWVVPAARPEDRQRHSA
Download sequence
Identical sequences C7M0I5
WP_015798972.1.72805 525909.Afer_1571 gi|256372342|ref|YP_003110166.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]