SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 526218.Sterm_1630 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  526218.Sterm_1630
Domain Number 1 Region: 76-138
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000288
Family NfeD domain-like 0.0045
Further Details:      
 
Weak hits

Sequence:  526218.Sterm_1630
Domain Number - Region: 7-62
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit I-like 0.036
Family Cytochrome c oxidase subunit I-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 526218.Sterm_1630
Sequence length 143
Comment (Sebaldella termitidis ATCC 33386)
Sequence
MSSTFWVIVAGVFLVLELVIPGLVTVWFGLAGIVMIFLAPLIRDVNVEFYVFAAISFVLL
LLTRPIAKKYLYKNRKDDISFGNRTVGRETKISKILDEGIYEVALDDKMWRAISTDNLEV
NEKVIITGITGNRLILEKKINKK
Download sequence
Identical sequences D1AIA4
WP_012861084.1.35130 526218.Sterm_1630 gi|269120242|ref|YP_003308419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]