SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 526218.Sterm_3615 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  526218.Sterm_3615
Domain Number 1 Region: 791-1175
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.85e-131
Family PFOR PP module 0.00000000304
Further Details:      
 
Domain Number 2 Region: 416-666
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.62e-81
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000149
Further Details:      
 
Domain Number 3 Region: 5-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.41e-74
Family PFOR Pyr module 0.0000000333
Further Details:      
 
Domain Number 4 Region: 260-410
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.57e-46
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000206
Further Details:      
 
Domain Number 5 Region: 669-836
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.35e-19
Family Ferredoxin domains from multidomain proteins 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 526218.Sterm_3615
Sequence length 1178
Comment (Sebaldella termitidis ATCC 33386)
Sequence
MAKVMKTMDGNQAAAYASYAFTEVAGIYPITPSSPMAEYTDEWAAYGKKNLFGVPVKMAE
MQSEGGAAGTVHGSLQSGALTTTYTASQGLLLKIPNMYKIAGELLPGVMHVSARALSAQA
LSIFGDHSDIYSARQAGWSMLATGSVQQVMDLAGVAHLAAIKSRVPVLHFFDGFRTSHEI
QKVEVMDYKVYEDLIDMEAVTRFREHALNPEHPVTRGTAENDDIYFQTREVQNKFYDAVP
DIMNHYLKEISKVTGREYAPFVYYGDPNAEYVIVAMGSVTEAIKETVDLLISKGEKVGLL
SVHLYRPFSAKYFFDAMPKSVKRLGVLDRTKEPGATGEPLYLDVKSIYYGKENAPIIVGG
RYGLSSKDTTPEQIVAVYNNLKQPEPKDQFTIGIIDDVTFTSLPLAEPVFTGNADVTECL
FFGLGSDGTVGANKNSIKIIGDKTPLYSQGYFAYDSKKSGGVTRSHLRFSKDPIRSTYLV
TKANFVACSVPAYLGKYDMLTGLKEGGSFLLNSIWDADKVVEHLPNEIKKLLADRKAKFY
IINATAMAEEVGLGTRTNTIMQSAFFKLTNVIPYEEAKTYMKEYIEKTYGAKGQDIVKMN
WAAVDKGTEGLVEVTVDPAWSNLPVDKDIVDSGKPEFVKRIAEPINAVKGDELPVSAFLG
YEDGTFENGTTAYEKRGIAVNVPEWVPENCIQCNQCAFVCPHAVIRPFLINEEELAAAPE
GLTTIKAMGKGLEGLQYKIQVSTLDCTGCGSCVNVCPAPKGKAIKMEPIESQIDKGEKEN
TDYLFNKVSYKDHIMGKDNVKSSQFAQPLFEFSGACAGCGETPYVKLVTQLFGDRMMVAN
ATGCSSIYGGSAPATPYTTNADGEGPAWASSLFEDNAEYGFGMFLGVETLRNRIEVVMTN
TMNEVSPELQGLYKEWIENKQNGDKTKELRNKMLPLLEKESGQGAKEILSLKQYLVKKSQ
WIFGGDGWAYDIGYGGLDHVLASGEDVNVLVLDTELYSNTGGQASKSSPAASVEKFAASG
KPTKKKDLAAISMTYGNIYVAQISMGANQNQALKAFKEAEAYPGPSIVIAYSPCIAHGIK
EGMGKSQTEEKLATEAGYWPIFRFDPRLIEQGKNPLQIDCKDPDWDKFEDYLKRERRYTI
LAGEFPERAKVLFAQNKSNAQDRWNYYKRLASLDYSQN
Download sequence
Identical sequences D1ARG3
526218.Sterm_3615 WP_012863031.1.35130 gi|269122203|ref|YP_003310380.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]