SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 526218.Sterm_3639 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  526218.Sterm_3639
Domain Number 1 Region: 188-438
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.73e-65
Family PFOR Pyr module 0.0078
Further Details:      
 
Domain Number 2 Region: 4-210
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.62e-31
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0046
Further Details:      
 
Domain Number 3 Region: 446-550
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000000754
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 526218.Sterm_3639
Sequence length 551
Comment (Sebaldella termitidis ATCC 33386)
Sequence
MDEISIVLSGEAGKGLKTVEEMVTKILAQDGYNIYASKEIMSRVRGGNNTTQIRVSNSYI
GSYVNKTDFLFVFNPNALYRLEDRIQKETVIIGPKSFFKEEDFGKYNIKEAEFLRLASEI
GNPIYSNTIVMGMILGMLNATKEEVYKALDEKFARKGEKLVQENIAAFEKGYSLGEEYKL
NLKKGEPQKHISGNEAVTYGAAAGGMNFVAAYPMSPGTDVVMLAAQWEKEFGIIVEQAED
EIAAVNMVLGAWYAGARAMTSTSGGGFALMEEAISMSGIGELPLVIHNAMRPGPGTGLPT
RTEQGDLNLAMYAGHGDFPRVLLAPTSLESGVELGQKAFNIADKYQVPVIILSDANYLSQ
SMNLGKVNLEENEYHVVESTEDYKRYQYTESGISPRSVPGYGKGLVKVDSDEHTEEGLIT
EDFDVRIKMMDKRMKKLDKYVDIEPELVGNPDYETLIVGWGSTYGAIKEALLKSGNEKTA
FLSFKQVFPLPKSTKSYLDKAKKLVLIENNAVGHFGDLIKLKTGVEFHKKVLKYNGLPFN
IEELIQEIGEY
Download sequence
Identical sequences D1ARI7
WP_012863055.1.35130 gi|269122227|ref|YP_003310404.1| 526218.Sterm_3639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]