SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 526218.Sterm_3753 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  526218.Sterm_3753
Domain Number 1 Region: 4-147
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 2.22e-34
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 526218.Sterm_3753
Sequence length 150
Comment (Sebaldella termitidis ATCC 33386)
Sequence
MREIDKDLIFINMNFENKSELFGFIADELKKRNYVTDTYEEAVNKREEKFPTGFQLKNIN
IAMPHADPVNSRADKLVVLTLEKPVEFQNAEDKGMIGVNIVFGLVFHNRDKHIDYLMRLS
NLIQDSGKLEKIKKSVTKDEIYDLLDETFK
Download sequence
Identical sequences D1ARV1
WP_012863169.1.35130 gi|269122341|ref|YP_003310518.1| 526218.Sterm_3753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]