SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 526222.Desal_3832 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  526222.Desal_3832
Domain Number 1 Region: 15-195
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.79e-25
Family Clp protease, ClpP subunit 0.025
Further Details:      
 
Domain Number 2 Region: 372-433
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000549
Family NfeD domain-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 526222.Desal_3832
Sequence length 436
Comment (Desulfovibrio salexigens DSM 2638)
Sequence
MHGSKRCSVFIYCSIIIAMFFLCLPVESLFAKEVNVLSLEIQGSISPAQVHLLEDALEQA
GDDNHDLVLLRLDTPGGLGTSMRELVKIIMNSKIPICVWVGPEGAHAASAGTFITAAAQV
AAMSPGTSIGAASPVSSSGDELPETMSKKVTGDMVSLIKGIARKRGRNIGWYAKSVQDGV
SVDAQDAVTLNIVDFMALSVDDFLEQLGARGVLIDGKKVKFTRADAAVIKFEPGFRYAVL
SWLLDPQIAYFLLLGGILGLFFELTHPGVILPGVIGAFCLVTGLYAMSVLPTNAAGLLLL
LLGAVLFLLEVFIVSYGLLSLGAVISLFVGSLVLFREGTPGIPLGTILGTVFTFAAFIGV
IVYLVAKAQISKSGVGMDSMIGLEGEVLELKGEIMKVRVRGEIWNAETIDKTFFNPGTMI
KVVEARGLTLIIVRNS
Download sequence
Identical sequences C6BUT3
gi|242281287|ref|YP_002993416.1| WP_015853693.1.7152 526222.Desal_3832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]