SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 526226.Gbro_3162 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  526226.Gbro_3162
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.75e-34
Family Chaperone J-domain 0.0002
Further Details:      
 
Domain Number 2 Region: 265-349
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.44e-19
Family HSP40/DnaJ peptide-binding domain 0.0016
Further Details:      
 
Domain Number 3 Region: 136-216
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 1.07e-18
Family DnaJ/Hsp40 cysteine-rich domain 0.00018
Further Details:      
 
Domain Number 4 Region: 117-140,192-270
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.00000000000000157
Family HSP40/DnaJ peptide-binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 526226.Gbro_3162
Sequence length 387
Comment (Gordonia bronchialis DSM 43247)
Sequence
MARDYYGILGVPQGASEQEIKRAYRKKARELHPDVNPGEEERFKEVSTAYEVLSDPEKRR
IVDAGGDPLATAGAGGFGGGFGGGGFGDVFEAFFGSGGAFGGGGGFGGGRGPRSRVQPGE
PALVAVELDLAECASGVNKEITVDTAILCDVCTGSGTNGTSKPVTCDTCEGNGQIQAVQR
SLLGQVMTVRECPTCHGVGEVIADPCHKCGGDGRVRSRRTMTVRIPAGIESGMRVRLAGQ
GEVGPGGGPAGDLYVEISERPHEVFMRDKDDLHCTLRVPMADAALGAEFSVDTILGDPVT
VAIAAGTQPGQVVKLRGQGMPHVNSGVRGTMHVHLDVVVPAKLDSAQAAALKRFRETSDD
QIEIVSTTSAAGPGGLFSRLRNAFAGR
Download sequence
Identical sequences D0LBY0
WP_012834883.1.40537 526226.Gbro_3162 gi|262203052|ref|YP_003274260.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]