SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 529507.PMI2171 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  529507.PMI2171
Domain Number 1 Region: 90-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000275
Family NfeD domain-like 0.0043
Further Details:      
 
Weak hits

Sequence:  529507.PMI2171
Domain Number - Region: 31-91
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000209
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 529507.PMI2171
Sequence length 173
Comment (Proteus mirabilis)
Sequence
MIEWISAQPALFWLCLGVLLLIAEMLGTAGYLLWSGMAALCVALIAWILPIGWPIQGILF
ALLTVISAILWRIWLKRKKLSKEAENLNQKSHQLIGIKAVLLSDTENGFSRIKLADGSWR
VYSDTPLKAGDTVKVIAIDGITLHVTSFSPTTRSASSTQHAAVIDDDNNQKDD
Download sequence
Identical sequences A0A2K0P0E2 B4F1N9
WP_004250295.1.100901 WP_004250295.1.11450 WP_004250295.1.11678 WP_004250295.1.16754 WP_004250295.1.2377 WP_004250295.1.24664 WP_004250295.1.25735 WP_004250295.1.27951 WP_004250295.1.30753 WP_004250295.1.34549 WP_004250295.1.37038 WP_004250295.1.46530 WP_004250295.1.63542 WP_004250295.1.64571 WP_004250295.1.65664 WP_004250295.1.737 WP_004250295.1.80156 WP_004250295.1.84357 WP_004250295.1.8491 WP_004250295.1.90684 WP_004250295.1.97310 529507.PMI2171 gi|197286018|ref|YP_002151890.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]