SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5306.JGI63847 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5306.JGI63847
Domain Number 1 Region: 85-161
Classification Level Classification E-value
Superfamily SMR domain-like 1.44e-17
Family Smr domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5306.JGI63847
Sequence length 191
Comment (Phanerochaete chrysosporium)
Sequence
VQDANRVNQSDSHYTALRARANEEGDAMAKAFEESHQAYARGDGALAKELSNKGKRHQAE
MERLNREAAEADCAAENNEDSKPGEVDLHGLYVKEAITYTDRAIQEAKARGDSEVHIIVG
KGLHSKNGAAKIKPAIEDLMRKHQLVAELDPQNSGVLIVSLDGHDKGTGNVVQPEDLARG
LQGEGDRCVIM
Download sequence
Identical sequences 5306.JGI63847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]