SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 536230.GBP346_A0303 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  536230.GBP346_A0303
Domain Number 1 Region: 731-971
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.31e-24
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.016
Further Details:      
 
Domain Number 2 Region: 27-210
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4e-17
Family Pyruvate oxidase and decarboxylase Pyr module 0.085
Further Details:      
 
Domain Number 3 Region: 441-628
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000000108
Family Pyruvate oxidase and decarboxylase PP module 0.035
Further Details:      
 
Weak hits

Sequence:  536230.GBP346_A0303
Domain Number - Region: 276-400
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00188
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 536230.GBP346_A0303
Sequence length 1191
Comment (Burkholderia pseudomallei MSHR346)
Sequence
MNARLPIDGPPALADYRLTDNLSATRGRIFLTGTQALVRLLLMQRALDAAQGVNTAGFVS
GYRGSPLGMVDQQLWKAKKQLDASGVRFLPAINEELGGTAVLGTQRVEADPQRTVDGVFA
MWYGKGPGVDRAGDALKHGNAYGSSPHGGVLVVAGDDHGCVSSSMPHQSDFAMIAWHMPV
VNPSNIADMLEFGLYGWALSRYSGAWVGFKAISETVESGSTVDLDALAMRWPAPEGFAPP
EGGLHNRWPDLPSLTIEARLAAKLDAVRHFARANSIDKWIAKSARANVGIVTCGKAHLDL
MEALRRLDLTAADLDAAGVRIYKVGLSFPLEMTRIDTFVEGLAEVLVIEEKGPVIEQQIK
DHLYNRAAGARPVVLGKHDAAGAPLLSELGELRPSRILPVFAEWLARHKPALDRRARVVD
LVAPSILSNEADAVRRTPYFCSGCPHNTSTKVPEGSIAQAGIGCHFMASWMERDTTGLIQ
MGGEGVDWAAHAMFTNTRHVFQNLGDGTYFHSGILAIRQAVAARANITYKILYNDAVAMT
GGQPVDGSISVPQIARQVEAEGVSRFVVVSDEPEKYDGHHDLFPKGTTFHHRRELDAVQR
ELRETSGVTVLIYDQTCAAEKRRRRKKGEFPDPDRRLFINEAVCEGCGDCGVQSNCLSVE
PVETALGRKRRIDQSSCNKDFSCANGFCPSFVTVEGATLKKAAGVAFDEAALAARVGALP
RPATHLADAPYDMLVTGVGGTGVVTVGALVSMAAHLEGKSASVLDFMGFAQKGGAVLSFV
RIASSDAWLNQVRIDTQQADVLLACDMVVGASADALQTVRRERTRIVVNTHAIPNAAFVR
DPDASLHADALVEKMRHAAGDGFLARCDAQALATKFLGDTIGANILMLGFAWQQGLVPVS
LDAMMRAIELNNVAVPMNKLAFSIGRMAAADAAGLDALWDARHPVHAPPLPQTLDAIVAD
REARLADYGGARYVARYRALVGAARATGDERLARAVATTFYRLLAVKDEYEVARLYTDGA
FRTALEAQFEGAAGKDFRVKFNLAPPATAKAGRHGAAPRKQMFGQWLWPVLGVLARVRGL
RGTWLDPFGGTVERKMERALADDYETTMHRAFAAHSPQTAELVARLAELHAKVRGYGHVK
LANVAGVKRSERELAARLSIDAATSDAVRHALDEMKGAGALRGIAVVVAKS
Download sequence
Identical sequences A0A0E1U2X9 A0A0H3HTV0 A0A1X4FU54 A8E8S8 C4KNN1 Q63Y33
gi|237810579|ref|YP_002895030.1| 272560.BPSL0356 536230.GBP346_A0303 gi|386863182|ref|YP_006276131.1| gi|53717996|ref|YP_106982.1| WP_004530989.1.100195 WP_004530989.1.100583 WP_004530989.1.100825 WP_004530989.1.101783 WP_004530989.1.10359 WP_004530989.1.10746 WP_004530989.1.11893 WP_004530989.1.11996 WP_004530989.1.12860 WP_004530989.1.13309 WP_004530989.1.13504 WP_004530989.1.13603 WP_004530989.1.14539 WP_004530989.1.15696 WP_004530989.1.16625 WP_004530989.1.17473 WP_004530989.1.17748 WP_004530989.1.17786 WP_004530989.1.18396 WP_004530989.1.18549 WP_004530989.1.18631 WP_004530989.1.19629 WP_004530989.1.19842 WP_004530989.1.20954 WP_004530989.1.21304 WP_004530989.1.21409 WP_004530989.1.22299 WP_004530989.1.22308 WP_004530989.1.23131 WP_004530989.1.2317 WP_004530989.1.24134 WP_004530989.1.2462 WP_004530989.1.24701 WP_004530989.1.26633 WP_004530989.1.26838 WP_004530989.1.27363 WP_004530989.1.27399 WP_004530989.1.2767 WP_004530989.1.28594 WP_004530989.1.29161 WP_004530989.1.29948 WP_004530989.1.30311 WP_004530989.1.30937 WP_004530989.1.31343 WP_004530989.1.31723 WP_004530989.1.32174 WP_004530989.1.324 WP_004530989.1.32951 WP_004530989.1.33165 WP_004530989.1.33493 WP_004530989.1.35025 WP_004530989.1.35052 WP_004530989.1.35141 WP_004530989.1.36106 WP_004530989.1.366 WP_004530989.1.37446 WP_004530989.1.37519 WP_004530989.1.37627 WP_004530989.1.37702 WP_004530989.1.38115 WP_004530989.1.38683 WP_004530989.1.3947 WP_004530989.1.39898 WP_004530989.1.40021 WP_004530989.1.40426 WP_004530989.1.43373 WP_004530989.1.43581 WP_004530989.1.43727 WP_004530989.1.44234 WP_004530989.1.46829 WP_004530989.1.46969 WP_004530989.1.47149 WP_004530989.1.48165 WP_004530989.1.50320 WP_004530989.1.50401 WP_004530989.1.50636 WP_004530989.1.50839 WP_004530989.1.52521 WP_004530989.1.5292 WP_004530989.1.53034 WP_004530989.1.53132 WP_004530989.1.53282 WP_004530989.1.5338 WP_004530989.1.53386 WP_004530989.1.53506 WP_004530989.1.55996 WP_004530989.1.56248 WP_004530989.1.56451 WP_004530989.1.57096 WP_004530989.1.58105 WP_004530989.1.59255 WP_004530989.1.59519 WP_004530989.1.60769 WP_004530989.1.60969 WP_004530989.1.61685 WP_004530989.1.62774 WP_004530989.1.63097 WP_004530989.1.63379 WP_004530989.1.63505 WP_004530989.1.64204 WP_004530989.1.64683 WP_004530989.1.65832 WP_004530989.1.66257 WP_004530989.1.66380 WP_004530989.1.67013 WP_004530989.1.6765 WP_004530989.1.67914 WP_004530989.1.68664 WP_004530989.1.68886 WP_004530989.1.68922 WP_004530989.1.69094 WP_004530989.1.69918 WP_004530989.1.70096 WP_004530989.1.70280 WP_004530989.1.71392 WP_004530989.1.73521 WP_004530989.1.74177 WP_004530989.1.75001 WP_004530989.1.75027 WP_004530989.1.75075 WP_004530989.1.75677 WP_004530989.1.75776 WP_004530989.1.75883 WP_004530989.1.76290 WP_004530989.1.76432 WP_004530989.1.76575 WP_004530989.1.78029 WP_004530989.1.78759 WP_004530989.1.79052 WP_004530989.1.79725 WP_004530989.1.79782 WP_004530989.1.80098 WP_004530989.1.80614 WP_004530989.1.81511 WP_004530989.1.8388 WP_004530989.1.83967 WP_004530989.1.84002 WP_004530989.1.84375 WP_004530989.1.84654 WP_004530989.1.84866 WP_004530989.1.85443 WP_004530989.1.85467 WP_004530989.1.85584 WP_004530989.1.85641 WP_004530989.1.85774 WP_004530989.1.8585 WP_004530989.1.86872 WP_004530989.1.87652 WP_004530989.1.88682 WP_004530989.1.89514 WP_004530989.1.92367 WP_004530989.1.9280 WP_004530989.1.93844 WP_004530989.1.94286 WP_004530989.1.94498 WP_004530989.1.94520 WP_004530989.1.94926 WP_004530989.1.95672 WP_004530989.1.97058 WP_004530989.1.98218 WP_004530989.1.99061 YP_106982.1.59693 gi|556575920|ref|YP_008743704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]