SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 536232.CLM_1345 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  536232.CLM_1345
Domain Number 1 Region: 787-1170
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.62e-135
Family PFOR PP module 0.00000000325
Further Details:      
 
Domain Number 2 Region: 415-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.7e-89
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0000000429
Further Details:      
 
Domain Number 3 Region: 5-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.68e-79
Family PFOR Pyr module 0.0000000133
Further Details:      
 
Domain Number 4 Region: 259-414
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.26e-48
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000879
Further Details:      
 
Domain Number 5 Region: 665-832
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.36e-21
Family Ferredoxin domains from multidomain proteins 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 536232.CLM_1345
Sequence length 1172
Comment (Clostridium botulinum A2 Kyoto)
Sequence
MAKIMKTMDGNQAAAEASYAFTEVAAIYPITPSTPMAEGVDEWSAHGKKNIFGQSVKVVE
MQSEAGASGTVHGSLAAGALTTTYTASQGLLLMIPNLYKIAGELLPGVFHVSARALATHA
LSIFGDHQDVMATRQTGVALLAASNVQEVMDLANIAHLSAIKSRVPFLHFFDGFRTSHEY
QKIEIINYDDVAKLVDYNALKEFKSRALNPEHPTLKGTAQNPDIYFQGREASNKFYKEVP
NIVENYMREIEKITGRSYHPFDYYGDPDAENIIVAMGSVCDTIEETVDYLINKGQKVGII
KIHLYRPFCPTYFMKSLPKTVKKIAVLDRTKEPGSIGEPIYLDVCKVFYNTKDKPIIVGG
RYGLGSKDTRPSQIISVFDNLNQDNPKDGFTIGITDDVTNTSLPEKDVVDTTPEGTISCK
FWGLGSDGTVGANKTAVKIIGDNTDLYAQAYFSYDSKKSGGSTISHLRFGKDKIKSPYLI
YNADYIACHNKSFIYNFDVLKGLKKNGTFVLNCPWDEAELEEKLPASMKKYIAENNINFY
IIDGISIAQNIGLGGRINMIMQSAFFKLANVIPVNEAVELLKNSVEKTYGKKGEKIVEMN
KAAIDTGIDAVHKVNIPSSWKNAEVEPTSIKEEPDFIKKVQRPMSRHEGDELPVSAFNGM
EDGTFPLGTTSYEKRGIAVMIPEWQIDKCIQCNQCSYICPHSVIRAYLLNKDEKEKAPSA
FETKKATGKGLEELGYRIQISPLDCTGCGNCADVCPAPGKALIMKNAEEQIEMQSENWEF
GLNITTKENLMDPKTLKGSQFIRPLLEFHGACPGCGETPYIKLLTQLFGDRMMIANATGC
SSIWGGSAPSIPYTTNSQGKGPSWGNSLFEDNAEYGYGMYLAVKQIREKLAELMQEALNM
EINQDLKDAFKQWLESMDDGEHSKTATAKILEAMPNENYQNNPILNEIMEKKDYLIKKSH
WMIGGDGWAYDIGFGGLDHVLASGDDVNIFVMDTEIYSNTGGQCSKSTQTGAIAKFAAAG
KKIKKKDLGLMAMSYGYVYVAQIAMGANMNHTIKTIAEAEAYKGPSLIIAYAPCISHGIK
TGMGTSIAEEKKAVESGYWHLYRYNPMLKEEGKNPFTLDSREPTKSFKEFIQGEVRYSSL
MNIFPGIAEKMSDMAEQHARERYDNYKHLADK
Download sequence
Identical sequences A0A2I4M9C7 C1FKR8
gi|226948460|ref|YP_002803551.1| WP_003356227.1.14220 WP_003356227.1.14863 WP_003356227.1.15773 WP_003356227.1.16702 WP_003356227.1.16999 WP_003356227.1.26119 WP_003356227.1.27859 WP_003356227.1.29491 WP_003356227.1.32894 WP_003356227.1.36253 WP_003356227.1.36784 WP_003356227.1.42818 WP_003356227.1.43055 WP_003356227.1.44945 WP_003356227.1.45672 WP_003356227.1.46996 WP_003356227.1.49498 WP_003356227.1.50688 WP_003356227.1.51228 WP_003356227.1.52140 WP_003356227.1.56340 WP_003356227.1.57050 WP_003356227.1.59839 WP_003356227.1.61167 WP_003356227.1.66957 WP_003356227.1.67470 WP_003356227.1.67940 WP_003356227.1.69035 WP_003356227.1.69692 WP_003356227.1.70928 WP_003356227.1.76938 WP_003356227.1.77051 WP_003356227.1.79827 WP_003356227.1.8456 WP_003356227.1.87449 WP_003356227.1.87856 WP_003356227.1.88000 WP_003356227.1.90975 WP_003356227.1.9205 WP_003356227.1.93526 WP_003356227.1.94833 WP_003356227.1.95223 WP_003356227.1.96382 WP_003356227.1.96416 WP_003356227.1.96493 WP_003356227.1.96844 WP_003356227.1.9927 536232.CLM_1345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]