SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 536232.CLM_3126 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  536232.CLM_3126
Domain Number 1 Region: 784-1191
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.23e-129
Family PFOR PP module 0.00000000224
Further Details:      
 
Domain Number 2 Region: 415-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.1e-88
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0000000405
Further Details:      
 
Domain Number 3 Region: 3-257
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.24e-78
Family PFOR Pyr module 0.0000000164
Further Details:      
 
Domain Number 4 Region: 258-412
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.26e-48
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000846
Further Details:      
 
Domain Number 5 Region: 665-829
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.88e-22
Family Ferredoxin domains from multidomain proteins 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 536232.CLM_3126
Sequence length 1192
Comment (Clostridium botulinum A2 Kyoto)
Sequence
MRRMKTMDGNTAAAYISYAFTDVAAIYPITPSSPMAEHVDEWVAQGKKNIFGQPVKVMEM
QSEAGAAGAVHGSLQAGALTTTYTASQGLLLMIPNMYKIAGELLPGVFHVSARALAANSL
NIFGDHQDVMAARQTGLALLAESSVQQVMDLSAVAHLSAIEGRVPFINFFDGFRTSHEIQ
KVEVLEYDELENLVDMDGVKAFRRRALNPDHPVIRGTAQNPDIYFQEREISNNYYERLPE
IVEKYMGEISKLTGREYHLFNYYGAEDAERLIIAMGSACDTVEEVVDYLMAKGEKVGLLT
VHLYRPFSLEHFFKYIPKTVKNIAVLDRTKEPGALAEPLYLDVKNAFYGKEWQPTIVGGR
YGLGSKEVYPSHILSVYENLKKDEPKDGFTIGIVDDVTNTSLEEAEAINTTPAGTTACKF
WGLGSDGTVGANKSAIKIIGDHTDMYAQGYFAYDSKKSGGITISHLRFGKSPIQSPYLIN
QADFVACHNQSYVYKYNVLEGLKKGGRFLLNTIWTPEEVEEHLPASMKKYIAENDIEFYT
LNAVKIAQGIGLGGRINMICQAAFFKIANIIPVEDAVKYLKDAVVTNYGKKGQKIIDMNN
AAIDEGVNAIVKIEVPASWKDAKCEGACEAKENPEFIKNIVEPMNRQEGDKLPVSAFKGM
EDGTFPSGTAAYEKRGIAINVPEWQLDKCIQCNQCSYVCPHAVIRPILLTDEEVKNAPEG
FKSKPAVGAKGLNFTMAISPYDCTGCGNCADVCPAKEKALIMKPFDSQIEESKKWDYAIK
VSPKANPMKKNSVKGSQFEQPLLEFSGACAGCGETPYAKLVTQLFGDRMMIANATGCSSI
WGASAPSTPYTTNHKGYGPAWANSLFEDNAEFGMGMYLGVKQIRDKVTEDVKAVLGFKSA
EELQSCAIGTEDCSEKDMTGTVISGELRAALEDWLNNKDLGEGTRERADKVIELVGKEKG
SDKFLNEIYENKDFLVKRSHWIFGGDGWAYDIGYGGVDHVLASGEDVNILVFDTEVYSNT
GGQSSKATPTAAIAKFAASGKKTKKKDLGAMAMTYGYVYVAQIAMGADKNQTLKAIAEAE
AYPGPSLIIAYAPCINHGLKAGMGCSQLEEKKAVDCGYWGLYRFNPELKEAGKNPFSLDS
KEPTANFKDFLMGEVRYASLAKQFPQDAEALFAKTEQDAKERLENYKKLAEQ
Download sequence
Identical sequences A0A2I4NL16 C1FUF8
WP_012704520.1.101508 WP_012704520.1.14863 WP_012704520.1.16999 WP_012704520.1.17007 WP_012704520.1.27859 WP_012704520.1.29491 WP_012704520.1.32894 WP_012704520.1.36253 WP_012704520.1.43055 WP_012704520.1.44945 WP_012704520.1.45672 WP_012704520.1.46996 WP_012704520.1.51228 WP_012704520.1.57050 WP_012704520.1.67940 WP_012704520.1.69692 WP_012704520.1.70928 WP_012704520.1.76938 WP_012704520.1.77051 WP_012704520.1.79827 WP_012704520.1.87856 WP_012704520.1.90975 WP_012704520.1.93232 WP_012704520.1.94833 WP_012704520.1.95223 536232.CLM_3126 gi|226950172|ref|YP_002805263.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]