SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 550537.SEN1401 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  550537.SEN1401
Domain Number 1 Region: 794-1162
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.19e-117
Family PFOR PP module 0.0000000358
Further Details:      
 
Domain Number 2 Region: 419-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.36e-75
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000114
Further Details:      
 
Domain Number 3 Region: 2-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.04e-72
Family PFOR Pyr module 0.0000000988
Further Details:      
 
Domain Number 4 Region: 256-411
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.14e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000221
Further Details:      
 
Domain Number 5 Region: 665-838
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 5.44e-23
Family Ferredoxin domains from multidomain proteins 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 550537.SEN1401
Sequence length 1174
Comment (Salmonella enterica serovar Enteritidis P125109)
Sequence
MQTIDGNGAVASVAFRTSEVIAIYPITPSSTMAEQADAWAGNGLKNVWGDTPRVVEMQSE
GGAIAAVHGALQTGSLSTSFTSSQGLLLMIPTLYKLAGQLTPFVLHVAARTVATHALSIF
GDHSDVMAVRQTGCAMLCAASVQEAQDFALIAHRATLKSRVPFIHFFDGFRTSHEINKII
PLTNETILNLMPQAEIDAHRARALNPEHPVIRGTSANPDTYFQSREATNPWYNAVYDHVE
EAMKAFGDATGRQYQPFEYYGHPQAERVIIMMGSALGTCEEVVDELLIRGEKVGVLKVRL
FRPFSAKHLLQALPETVRAIAVLDRTKEPGAQAEPLYLDVMTALAEAFNNGERETLPRTI
GGRYGLSSKEFGPACVLAVFNELSRAKPKPRFTVGIYDDVTNLSLPLPENTLPGSAKLEA
LFYGLGSDGSVSATKNNIKIIGNSTPWYAQGYFVYDSKKAGGLTVSHLRVSEKPIRSAYL
IAQADFVGCHQLQFIDKYQMAERLKPGGIFLLNTPYSADEVWSRLPQEVQAVLNQKKARF
YVVNAAKIARECGLGARINTVMQMAFFHLTHILPGDSALVELQGAIAKSYSSKGQDLVER
NWQALALAQESLAEVPLQAVNPHSAHRPPVVSDAAPDFVKTVTAAMLAGLGDALPVSALP
PDGTWPMGTTRWEKRNIAEEIPVWKEELCTQCNHCVAACPHSAIRAKVVSPQAMENAPAS
LHSLDVKSRDMRGQKYVLQVAPEDCTGCNLCVEVCPAKDRQNPQIKAINMMSRLEHVEEE
KVNYDFFLDLPEIDRSKLERIDIRTSQLITPLFEYSGACSGCGETPYIKLLTQLYGDRML
IANATGCSSIYGGNLPSTPYTTDANGRGPAWANSLFEDNAEFGLGFRLSVDQHRARVMRL
LAQFADRIPAELNDALHAEATPDVRREQVAALRQHLKSVAGAEELLKDADALVEKSIWLI
GGDGWAYDIGFGGLDHVLSLTENVNILVLDTQCYSNTGGQASKATPLGAVTKFGEHGKRK
ARKDLGVSMMMYGHVYVAQISLGAQLNQTVKAIQEAEAWPGPSLIIAYSPCEEHGYDLAL
SHDQMRQLTATGFWPLYRFDPRRADEGKPPLALDSRPPSDALAETLLNEQRFRRLNAQQP
EVAEQLWRDAALDLQKRYDFLALLAGKAEKPGAD
Download sequence
Identical sequences A0A1X8WF49 A0A232RSZ1 A0A2J0RVF2 S4IRH1
ABEW01000001|CDS_353571-350047 AM933172|CDS_1486960-1483436 CP001144|CDS_1626482-1622958 WP_001193266.1.100077 WP_001193266.1.100149 WP_001193266.1.100191 WP_001193266.1.100392 WP_001193266.1.100412 WP_001193266.1.100457 WP_001193266.1.100557 WP_001193266.1.100605 WP_001193266.1.100776 WP_001193266.1.10081 WP_001193266.1.100857 WP_001193266.1.100895 WP_001193266.1.101112 WP_001193266.1.101123 WP_001193266.1.101541 WP_001193266.1.101634 WP_001193266.1.101674 WP_001193266.1.101832 WP_001193266.1.101917 WP_001193266.1.102111 WP_001193266.1.10237 WP_001193266.1.10300 WP_001193266.1.10498 WP_001193266.1.10631 WP_001193266.1.10755 WP_001193266.1.10868 WP_001193266.1.10898 WP_001193266.1.11119 WP_001193266.1.1150 WP_001193266.1.11526 WP_001193266.1.11528 WP_001193266.1.1156 WP_001193266.1.1169 WP_001193266.1.1174 WP_001193266.1.11824 WP_001193266.1.11841 WP_001193266.1.11900 WP_001193266.1.11978 WP_001193266.1.12027 WP_001193266.1.12106 WP_001193266.1.1215 WP_001193266.1.12168 WP_001193266.1.12340 WP_001193266.1.12374 WP_001193266.1.12485 WP_001193266.1.12568 WP_001193266.1.12569 WP_001193266.1.12585 WP_001193266.1.12696 WP_001193266.1.1300 WP_001193266.1.13076 WP_001193266.1.13102 WP_001193266.1.13247 WP_001193266.1.13274 WP_001193266.1.13367 WP_001193266.1.13391 WP_001193266.1.1346 WP_001193266.1.13573 WP_001193266.1.13625 WP_001193266.1.1412 WP_001193266.1.146 WP_001193266.1.14708 WP_001193266.1.14793 WP_001193266.1.14819 WP_001193266.1.14913 WP_001193266.1.15067 WP_001193266.1.15276 WP_001193266.1.15318 WP_001193266.1.15585 WP_001193266.1.1568 WP_001193266.1.15777 WP_001193266.1.158 WP_001193266.1.16363 WP_001193266.1.16365 WP_001193266.1.16366 WP_001193266.1.16394 WP_001193266.1.16729 WP_001193266.1.16949 WP_001193266.1.16972 WP_001193266.1.17060 WP_001193266.1.17096 WP_001193266.1.17098 WP_001193266.1.17105 WP_001193266.1.1733 WP_001193266.1.17482 WP_001193266.1.17525 WP_001193266.1.17583 WP_001193266.1.17732 WP_001193266.1.17886 WP_001193266.1.17914 WP_001193266.1.17936 WP_001193266.1.18056 WP_001193266.1.18061 WP_001193266.1.18092 WP_001193266.1.18109 WP_001193266.1.18149 WP_001193266.1.18384 WP_001193266.1.18641 WP_001193266.1.18686 WP_001193266.1.18737 WP_001193266.1.18847 WP_001193266.1.18886 WP_001193266.1.1895 WP_001193266.1.19093 WP_001193266.1.19373 WP_001193266.1.19433 WP_001193266.1.1955 WP_001193266.1.19656 WP_001193266.1.19834 WP_001193266.1.20086 WP_001193266.1.20261 WP_001193266.1.2041 WP_001193266.1.20437 WP_001193266.1.2107 WP_001193266.1.21079 WP_001193266.1.21103 WP_001193266.1.2116 WP_001193266.1.21194 WP_001193266.1.21202 WP_001193266.1.21241 WP_001193266.1.21332 WP_001193266.1.21681 WP_001193266.1.21715 WP_001193266.1.21909 WP_001193266.1.21950 WP_001193266.1.22051 WP_001193266.1.22096 WP_001193266.1.22136 WP_001193266.1.22158 WP_001193266.1.22162 WP_001193266.1.22296 WP_001193266.1.22346 WP_001193266.1.22449 WP_001193266.1.22454 WP_001193266.1.22460 WP_001193266.1.22595 WP_001193266.1.22605 WP_001193266.1.22760 WP_001193266.1.22857 WP_001193266.1.22902 WP_001193266.1.22947 WP_001193266.1.2324 WP_001193266.1.23329 WP_001193266.1.23442 WP_001193266.1.23631 WP_001193266.1.23746 WP_001193266.1.24145 WP_001193266.1.24163 WP_001193266.1.24214 WP_001193266.1.24250 WP_001193266.1.24297 WP_001193266.1.24361 WP_001193266.1.24408 WP_001193266.1.24409 WP_001193266.1.24433 WP_001193266.1.24476 WP_001193266.1.24494 WP_001193266.1.24673 WP_001193266.1.24901 WP_001193266.1.24944 WP_001193266.1.25159 WP_001193266.1.25175 WP_001193266.1.25354 WP_001193266.1.25426 WP_001193266.1.25618 WP_001193266.1.25722 WP_001193266.1.25780 WP_001193266.1.25951 WP_001193266.1.26083 WP_001193266.1.26194 WP_001193266.1.26441 WP_001193266.1.26687 WP_001193266.1.2672 WP_001193266.1.26794 WP_001193266.1.26936 WP_001193266.1.27272 WP_001193266.1.27314 WP_001193266.1.27383 WP_001193266.1.27522 WP_001193266.1.27547 WP_001193266.1.27632 WP_001193266.1.27638 WP_001193266.1.27658 WP_001193266.1.27800 WP_001193266.1.27833 WP_001193266.1.27883 WP_001193266.1.27995 WP_001193266.1.28037 WP_001193266.1.28056 WP_001193266.1.28139 WP_001193266.1.28200 WP_001193266.1.28232 WP_001193266.1.28233 WP_001193266.1.28303 WP_001193266.1.28462 WP_001193266.1.2853 WP_001193266.1.28570 WP_001193266.1.28620 WP_001193266.1.29168 WP_001193266.1.2924 WP_001193266.1.2932 WP_001193266.1.29379 WP_001193266.1.29436 WP_001193266.1.29576 WP_001193266.1.3005 WP_001193266.1.30059 WP_001193266.1.30165 WP_001193266.1.30210 WP_001193266.1.30278 WP_001193266.1.30356 WP_001193266.1.30492 WP_001193266.1.30548 WP_001193266.1.30627 WP_001193266.1.30752 WP_001193266.1.30968 WP_001193266.1.31167 WP_001193266.1.31272 WP_001193266.1.31335 WP_001193266.1.31435 WP_001193266.1.31585 WP_001193266.1.3167 WP_001193266.1.31895 WP_001193266.1.31901 WP_001193266.1.32109 WP_001193266.1.32252 WP_001193266.1.32274 WP_001193266.1.32309 WP_001193266.1.32519 WP_001193266.1.32668 WP_001193266.1.32740 WP_001193266.1.32832 WP_001193266.1.32881 WP_001193266.1.32899 WP_001193266.1.32977 WP_001193266.1.33253 WP_001193266.1.33270 WP_001193266.1.33409 WP_001193266.1.335 WP_001193266.1.3356 WP_001193266.1.33586 WP_001193266.1.3364 WP_001193266.1.3396 WP_001193266.1.34185 WP_001193266.1.34259 WP_001193266.1.34292 WP_001193266.1.3438 WP_001193266.1.34431 WP_001193266.1.34454 WP_001193266.1.34614 WP_001193266.1.34711 WP_001193266.1.34820 WP_001193266.1.35298 WP_001193266.1.35321 WP_001193266.1.35563 WP_001193266.1.35570 WP_001193266.1.35594 WP_001193266.1.35624 WP_001193266.1.35887 WP_001193266.1.35936 WP_001193266.1.35961 WP_001193266.1.36037 WP_001193266.1.36063 WP_001193266.1.36409 WP_001193266.1.36445 WP_001193266.1.36584 WP_001193266.1.36685 WP_001193266.1.36721 WP_001193266.1.36751 WP_001193266.1.36764 WP_001193266.1.36889 WP_001193266.1.37029 WP_001193266.1.37114 WP_001193266.1.37191 WP_001193266.1.37297 WP_001193266.1.37405 WP_001193266.1.3748 WP_001193266.1.3771 WP_001193266.1.3778 WP_001193266.1.37864 WP_001193266.1.3790 WP_001193266.1.38037 WP_001193266.1.38047 WP_001193266.1.38344 WP_001193266.1.39048 WP_001193266.1.39055 WP_001193266.1.39065 WP_001193266.1.39312 WP_001193266.1.39395 WP_001193266.1.39576 WP_001193266.1.40081 WP_001193266.1.40307 WP_001193266.1.40493 WP_001193266.1.40533 WP_001193266.1.40577 WP_001193266.1.40622 WP_001193266.1.40648 WP_001193266.1.40695 WP_001193266.1.40745 WP_001193266.1.40849 WP_001193266.1.40973 WP_001193266.1.41116 WP_001193266.1.41128 WP_001193266.1.41192 WP_001193266.1.41277 WP_001193266.1.41427 WP_001193266.1.41528 WP_001193266.1.41610 WP_001193266.1.41690 WP_001193266.1.41799 WP_001193266.1.41911 WP_001193266.1.41949 WP_001193266.1.41978 WP_001193266.1.42136 WP_001193266.1.42248 WP_001193266.1.42263 WP_001193266.1.42322 WP_001193266.1.42392 WP_001193266.1.42605 WP_001193266.1.42666 WP_001193266.1.42675 WP_001193266.1.42683 WP_001193266.1.42734 WP_001193266.1.42892 WP_001193266.1.42923 WP_001193266.1.42932 WP_001193266.1.43201 WP_001193266.1.4344 WP_001193266.1.43711 WP_001193266.1.43785 WP_001193266.1.44010 WP_001193266.1.44337 WP_001193266.1.44443 WP_001193266.1.44474 WP_001193266.1.44678 WP_001193266.1.44705 WP_001193266.1.44831 WP_001193266.1.44833 WP_001193266.1.44966 WP_001193266.1.44978 WP_001193266.1.44997 WP_001193266.1.4500 WP_001193266.1.45173 WP_001193266.1.45302 WP_001193266.1.4531 WP_001193266.1.45432 WP_001193266.1.45549 WP_001193266.1.45569 WP_001193266.1.45571 WP_001193266.1.45583 WP_001193266.1.45844 WP_001193266.1.45906 WP_001193266.1.45918 WP_001193266.1.46215 WP_001193266.1.46406 WP_001193266.1.46444 WP_001193266.1.46578 WP_001193266.1.4671 WP_001193266.1.46726 WP_001193266.1.4674 WP_001193266.1.4686 WP_001193266.1.46967 WP_001193266.1.46976 WP_001193266.1.47507 WP_001193266.1.47567 WP_001193266.1.47576 WP_001193266.1.4758 WP_001193266.1.47829 WP_001193266.1.47850 WP_001193266.1.47875 WP_001193266.1.47911 WP_001193266.1.47988 WP_001193266.1.4839 WP_001193266.1.48797 WP_001193266.1.49233 WP_001193266.1.49311 WP_001193266.1.49334 WP_001193266.1.49770 WP_001193266.1.50003 WP_001193266.1.50128 WP_001193266.1.50332 WP_001193266.1.50449 WP_001193266.1.50652 WP_001193266.1.50684 WP_001193266.1.50882 WP_001193266.1.50960 WP_001193266.1.51285 WP_001193266.1.51308 WP_001193266.1.51356 WP_001193266.1.51412 WP_001193266.1.51451 WP_001193266.1.51502 WP_001193266.1.51514 WP_001193266.1.51642 WP_001193266.1.51764 WP_001193266.1.51810 WP_001193266.1.51868 WP_001193266.1.51888 WP_001193266.1.51930 WP_001193266.1.51994 WP_001193266.1.520 WP_001193266.1.5211 WP_001193266.1.52301 WP_001193266.1.52321 WP_001193266.1.52528 WP_001193266.1.52582 WP_001193266.1.52586 WP_001193266.1.52833 WP_001193266.1.53107 WP_001193266.1.53119 WP_001193266.1.5313 WP_001193266.1.53198 WP_001193266.1.53206 WP_001193266.1.53234 WP_001193266.1.53362 WP_001193266.1.53385 WP_001193266.1.53534 WP_001193266.1.53567 WP_001193266.1.53664 WP_001193266.1.53778 WP_001193266.1.53781 WP_001193266.1.53896 WP_001193266.1.53961 WP_001193266.1.54283 WP_001193266.1.54366 WP_001193266.1.54615 WP_001193266.1.54833 WP_001193266.1.54877 WP_001193266.1.54936 WP_001193266.1.55545 WP_001193266.1.55559 WP_001193266.1.55640 WP_001193266.1.5572 WP_001193266.1.5577 WP_001193266.1.55923 WP_001193266.1.55948 WP_001193266.1.56235 WP_001193266.1.56263 WP_001193266.1.5668 WP_001193266.1.56851 WP_001193266.1.56898 WP_001193266.1.56905 WP_001193266.1.57026 WP_001193266.1.57039 WP_001193266.1.57056 WP_001193266.1.5711 WP_001193266.1.57143 WP_001193266.1.57246 WP_001193266.1.57362 WP_001193266.1.57559 WP_001193266.1.57631 WP_001193266.1.57641 WP_001193266.1.57835 WP_001193266.1.57893 WP_001193266.1.58090 WP_001193266.1.5828 WP_001193266.1.58290 WP_001193266.1.58443 WP_001193266.1.58489 WP_001193266.1.58675 WP_001193266.1.58884 WP_001193266.1.58926 WP_001193266.1.58932 WP_001193266.1.59142 WP_001193266.1.59163 WP_001193266.1.59294 WP_001193266.1.59427 WP_001193266.1.59538 WP_001193266.1.59548 WP_001193266.1.59646 WP_001193266.1.59848 WP_001193266.1.60015 WP_001193266.1.60126 WP_001193266.1.60137 WP_001193266.1.60320 WP_001193266.1.6033 WP_001193266.1.60425 WP_001193266.1.60560 WP_001193266.1.60713 WP_001193266.1.608 WP_001193266.1.60866 WP_001193266.1.60897 WP_001193266.1.61356 WP_001193266.1.61381 WP_001193266.1.61501 WP_001193266.1.61594 WP_001193266.1.61595 WP_001193266.1.61671 WP_001193266.1.61908 WP_001193266.1.62158 WP_001193266.1.62201 WP_001193266.1.62210 WP_001193266.1.62412 WP_001193266.1.627 WP_001193266.1.62745 WP_001193266.1.62757 WP_001193266.1.6292 WP_001193266.1.62983 WP_001193266.1.62988 WP_001193266.1.63045 WP_001193266.1.63102 WP_001193266.1.63229 WP_001193266.1.63497 WP_001193266.1.63509 WP_001193266.1.63529 WP_001193266.1.63585 WP_001193266.1.63603 WP_001193266.1.6370 WP_001193266.1.63748 WP_001193266.1.63831 WP_001193266.1.63851 WP_001193266.1.63863 WP_001193266.1.64010 WP_001193266.1.64085 WP_001193266.1.64157 WP_001193266.1.64229 WP_001193266.1.64266 WP_001193266.1.64350 WP_001193266.1.6437 WP_001193266.1.64385 WP_001193266.1.64462 WP_001193266.1.64500 WP_001193266.1.64597 WP_001193266.1.64711 WP_001193266.1.65011 WP_001193266.1.65357 WP_001193266.1.65601 WP_001193266.1.65698 WP_001193266.1.6572 WP_001193266.1.65771 WP_001193266.1.65795 WP_001193266.1.65881 WP_001193266.1.65883 WP_001193266.1.65901 WP_001193266.1.6595 WP_001193266.1.66171 WP_001193266.1.66235 WP_001193266.1.66315 WP_001193266.1.66385 WP_001193266.1.66400 WP_001193266.1.66428 WP_001193266.1.66446 WP_001193266.1.66539 WP_001193266.1.66733 WP_001193266.1.6692 WP_001193266.1.66959 WP_001193266.1.67075 WP_001193266.1.6710 WP_001193266.1.67173 WP_001193266.1.67279 WP_001193266.1.6760 WP_001193266.1.6782 WP_001193266.1.67924 WP_001193266.1.67932 WP_001193266.1.68140 WP_001193266.1.68159 WP_001193266.1.68652 WP_001193266.1.68677 WP_001193266.1.68893 WP_001193266.1.68895 WP_001193266.1.69080 WP_001193266.1.69086 WP_001193266.1.69131 WP_001193266.1.69236 WP_001193266.1.69273 WP_001193266.1.69357 WP_001193266.1.69575 WP_001193266.1.69616 WP_001193266.1.69767 WP_001193266.1.69890 WP_001193266.1.69965 WP_001193266.1.70272 WP_001193266.1.70440 WP_001193266.1.70531 WP_001193266.1.70596 WP_001193266.1.70678 WP_001193266.1.70785 WP_001193266.1.70837 WP_001193266.1.70985 WP_001193266.1.71172 WP_001193266.1.71184 WP_001193266.1.71201 WP_001193266.1.71305 WP_001193266.1.71626 WP_001193266.1.71649 WP_001193266.1.71984 WP_001193266.1.720 WP_001193266.1.72100 WP_001193266.1.72190 WP_001193266.1.72221 WP_001193266.1.72300 WP_001193266.1.72325 WP_001193266.1.72339 WP_001193266.1.72382 WP_001193266.1.72532 WP_001193266.1.72602 WP_001193266.1.72716 WP_001193266.1.72718 WP_001193266.1.72827 WP_001193266.1.72865 WP_001193266.1.7295 WP_001193266.1.73068 WP_001193266.1.73708 WP_001193266.1.74117 WP_001193266.1.74174 WP_001193266.1.74207 WP_001193266.1.743 WP_001193266.1.74300 WP_001193266.1.74402 WP_001193266.1.74578 WP_001193266.1.74972 WP_001193266.1.74992 WP_001193266.1.75051 WP_001193266.1.75056 WP_001193266.1.75148 WP_001193266.1.75159 WP_001193266.1.75400 WP_001193266.1.75450 WP_001193266.1.7558 WP_001193266.1.75607 WP_001193266.1.75716 WP_001193266.1.75751 WP_001193266.1.75794 WP_001193266.1.75810 WP_001193266.1.75863 WP_001193266.1.75902 WP_001193266.1.76108 WP_001193266.1.76137 WP_001193266.1.76301 WP_001193266.1.76345 WP_001193266.1.76451 WP_001193266.1.76495 WP_001193266.1.76776 WP_001193266.1.76913 WP_001193266.1.76968 WP_001193266.1.77306 WP_001193266.1.77356 WP_001193266.1.77475 WP_001193266.1.77496 WP_001193266.1.77565 WP_001193266.1.7792 WP_001193266.1.7793 WP_001193266.1.77951 WP_001193266.1.77983 WP_001193266.1.77989 WP_001193266.1.7802 WP_001193266.1.78051 WP_001193266.1.78245 WP_001193266.1.78501 WP_001193266.1.78603 WP_001193266.1.78632 WP_001193266.1.78658 WP_001193266.1.78697 WP_001193266.1.78734 WP_001193266.1.7877 WP_001193266.1.78815 WP_001193266.1.78877 WP_001193266.1.78896 WP_001193266.1.79099 WP_001193266.1.79289 WP_001193266.1.79302 WP_001193266.1.79468 WP_001193266.1.79580 WP_001193266.1.79586 WP_001193266.1.7982 WP_001193266.1.79966 WP_001193266.1.80249 WP_001193266.1.80254 WP_001193266.1.80380 WP_001193266.1.80667 WP_001193266.1.80674 WP_001193266.1.80750 WP_001193266.1.80760 WP_001193266.1.80874 WP_001193266.1.80876 WP_001193266.1.8106 WP_001193266.1.81110 WP_001193266.1.81197 WP_001193266.1.8130 WP_001193266.1.81321 WP_001193266.1.8134 WP_001193266.1.81388 WP_001193266.1.81668 WP_001193266.1.81768 WP_001193266.1.82149 WP_001193266.1.82401 WP_001193266.1.82420 WP_001193266.1.82434 WP_001193266.1.8247 WP_001193266.1.82474 WP_001193266.1.82569 WP_001193266.1.83005 WP_001193266.1.83006 WP_001193266.1.83119 WP_001193266.1.83204 WP_001193266.1.83331 WP_001193266.1.83354 WP_001193266.1.83356 WP_001193266.1.83558 WP_001193266.1.83897 WP_001193266.1.83960 WP_001193266.1.8399 WP_001193266.1.84000 WP_001193266.1.84011 WP_001193266.1.84075 WP_001193266.1.84083 WP_001193266.1.84086 WP_001193266.1.84154 WP_001193266.1.84300 WP_001193266.1.84497 WP_001193266.1.84515 WP_001193266.1.84572 WP_001193266.1.84598 WP_001193266.1.84683 WP_001193266.1.84876 WP_001193266.1.84983 WP_001193266.1.85079 WP_001193266.1.85126 WP_001193266.1.8526 WP_001193266.1.85271 WP_001193266.1.85301 WP_001193266.1.85759 WP_001193266.1.85982 WP_001193266.1.86138 WP_001193266.1.86157 WP_001193266.1.8616 WP_001193266.1.86335 WP_001193266.1.86347 WP_001193266.1.86380 WP_001193266.1.8647 WP_001193266.1.86514 WP_001193266.1.86601 WP_001193266.1.86610 WP_001193266.1.86915 WP_001193266.1.87038 WP_001193266.1.87187 WP_001193266.1.87265 WP_001193266.1.87484 WP_001193266.1.87500 WP_001193266.1.87583 WP_001193266.1.87712 WP_001193266.1.87905 WP_001193266.1.87936 WP_001193266.1.88052 WP_001193266.1.88185 WP_001193266.1.88275 WP_001193266.1.88356 WP_001193266.1.88474 WP_001193266.1.88508 WP_001193266.1.88731 WP_001193266.1.88854 WP_001193266.1.88966 WP_001193266.1.88968 WP_001193266.1.88998 WP_001193266.1.89120 WP_001193266.1.89177 WP_001193266.1.89221 WP_001193266.1.89362 WP_001193266.1.89408 WP_001193266.1.89425 WP_001193266.1.89452 WP_001193266.1.89606 WP_001193266.1.8961 WP_001193266.1.89634 WP_001193266.1.89680 WP_001193266.1.89832 WP_001193266.1.89965 WP_001193266.1.9003 WP_001193266.1.90421 WP_001193266.1.90522 WP_001193266.1.90540 WP_001193266.1.90563 WP_001193266.1.90748 WP_001193266.1.90759 WP_001193266.1.90859 WP_001193266.1.90959 WP_001193266.1.90973 WP_001193266.1.90984 WP_001193266.1.91215 WP_001193266.1.9137 WP_001193266.1.91372 WP_001193266.1.91424 WP_001193266.1.91474 WP_001193266.1.91505 WP_001193266.1.91742 WP_001193266.1.91772 WP_001193266.1.91776 WP_001193266.1.91795 WP_001193266.1.91898 WP_001193266.1.91904 WP_001193266.1.91974 WP_001193266.1.92082 WP_001193266.1.92129 WP_001193266.1.9222 WP_001193266.1.92452 WP_001193266.1.92557 WP_001193266.1.92628 WP_001193266.1.92890 WP_001193266.1.92929 WP_001193266.1.93076 WP_001193266.1.93215 WP_001193266.1.93350 WP_001193266.1.93524 WP_001193266.1.93577 WP_001193266.1.9380 WP_001193266.1.93809 WP_001193266.1.9440 WP_001193266.1.94473 WP_001193266.1.94598 WP_001193266.1.94649 WP_001193266.1.94670 WP_001193266.1.94817 WP_001193266.1.94835 WP_001193266.1.95136 WP_001193266.1.9527 WP_001193266.1.95434 WP_001193266.1.95447 WP_001193266.1.95456 WP_001193266.1.95607 WP_001193266.1.95656 WP_001193266.1.95757 WP_001193266.1.9586 WP_001193266.1.95866 WP_001193266.1.95963 WP_001193266.1.96107 WP_001193266.1.9624 WP_001193266.1.96340 WP_001193266.1.96348 WP_001193266.1.96349 WP_001193266.1.96380 WP_001193266.1.96521 WP_001193266.1.96537 WP_001193266.1.96588 WP_001193266.1.96735 WP_001193266.1.96876 WP_001193266.1.96993 WP_001193266.1.97043 WP_001193266.1.97103 WP_001193266.1.97109 WP_001193266.1.97322 WP_001193266.1.97328 WP_001193266.1.97547 WP_001193266.1.97648 WP_001193266.1.97656 WP_001193266.1.97704 WP_001193266.1.9774 WP_001193266.1.97800 WP_001193266.1.97907 WP_001193266.1.9793 WP_001193266.1.97981 WP_001193266.1.97991 WP_001193266.1.98119 WP_001193266.1.98338 WP_001193266.1.98440 WP_001193266.1.98472 WP_001193266.1.98551 WP_001193266.1.98570 WP_001193266.1.98634 WP_001193266.1.98726 WP_001193266.1.98947 WP_001193266.1.99057 WP_001193266.1.99097 WP_001193266.1.99164 WP_001193266.1.99215 WP_001193266.1.99456 WP_001193266.1.99490 WP_001193266.1.99493 WP_001193266.1.99613 WP_001193266.1.99630 WP_001193266.1.99924 WP_001193266.1.99961 439851.SeD_A1688 550537.SEN1401 gi|198245539|ref|YP_002215497.1| gi|207856852|ref|YP_002243503.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]