SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 552536.LMHCC_1801 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  552536.LMHCC_1801
Domain Number 1 Region: 788-1186
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.33e-127
Family PFOR PP module 0.00000000445
Further Details:      
 
Domain Number 2 Region: 415-663
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.62e-77
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000193
Further Details:      
 
Domain Number 3 Region: 3-257
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.12e-73
Family PFOR Pyr module 0.0000000504
Further Details:      
 
Domain Number 4 Region: 259-407
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.28e-46
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000337
Further Details:      
 
Domain Number 5 Region: 668-833
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.26e-20
Family Ferredoxin domains from multidomain proteins 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 552536.LMHCC_1801
Sequence length 1215
Comment (Listeria monocytogenes HCC23)
Sequence
MRNRKTMDGNTAAAYISYAFTEVAAIYPITPSSTMAELVDEWSSKNKKNLFNEPVKVVEM
QSEAGAAGTVHGSLQAGALTSTYTASQGLLLMIPNMYKIAGELLPTVFHVSARTISAASL
NIFGDHSDVMAARQTGFAMLAEGSVQEVMDLSAVAHLASLKGSLPFLNFFDGFRTSHELQ
KVEVLEYDELENSLDKEALQQFRNRAMTPNNPKTLGSNQNPDIFFQQRETVNRYYEEIPN
IVQNYMKEINQLRGTDYDLVNYYGAEDATDVIVAMGSVTPVIEQVIDYLTTQGKKVGLLN
IRLYRPFPAETFLAKLPKTVERVAVLDRTKEPGSGGEPLLLDVQSVLYDSETRPLVIGGR
YGLGSKDVTPDQILGVYSHLTTENPKPRFTIGITDDITNLSIENTGPSDLTSEKTFQCKF
WGFGSDGTVGANKAAIKIIGDNTDLYAQGYFSYDSKKSGGLTVSHLRFGEKRIRSAYLIQ
QADFVSCSTSAYLRSYDLLKGLKPGGTFLLNTIWEGKQLERHLPAAMREYIAKNNIQFYT
LNAMRIAGEAGLGRRINTVMQTAFFRVTDILPFEKALADLKASAIATYGKKDMAVAEKNI
FAMDQTVANLHKVEVPASWANPVVTAETNATTEKPAYVQNILEPVNRLEGDNLTVGDLIS
NGMVSGAYPPGTAAYEKRGIALEVPEWISENCTMCNECAFVCPHAAIRPILTDEEEMESA
PEGFMTREMRGKDGLRYRIQVSPMDCTGCNLCAETCPAKDKALVMKPFEEVAAKENPNWS
FAINVKPKKNPGKKNTVPGSQFEQPLLEFSGACAGCGETPYVKLLTQMFGDRMMIANATG
CSSIWGASAPATPYTVNDKGHGPAWGNSLLEDNAEYGYGMYLANQTMRKALNNKVTKALR
EEAMSETLREALVDWQTQMDVSEDTRERAEALQLALLSEMEDSAALESIYNDRELFIKRS
QWMLGGDGWAYDIGFGGIDHVLASGEDVNIFVMDNEVYSNTGGQSSKATPTAAIAKFASG
GKSVGKKDLGIMAMSYGNIYVAQIAMGANKRQTLKAIEEAEAYPGPSLIIAYTPCINHGI
SSGMKTMLSETQKAVECGYWSLYRYNPALEEKGKNPMTMDYKKVDFDQFEDFLKRETRYS
ALYKANPDVATKLSEKTRLDAEKRFKRYATMAGLDLEKILKKKEVTEEVKAPVDDERAAR
KAAREARRLAREQGK
Download sequence
Identical sequences A0A0E0UUT4
gi|386007552|ref|YP_005925830.1| gi|217965078|ref|YP_002350756.1| 552536.LMHCC_1801 WP_012581700.1.33039 WP_012581700.1.53566 WP_012581700.1.90135 WP_012581700.1.98375 gi|386026145|ref|YP_005946921.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]