SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 554290.SSPA2065 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  554290.SSPA2065
Domain Number 1 Region: 107-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000418
Family NfeD domain-like 0.0063
Further Details:      
 
Weak hits

Sequence:  554290.SSPA2065
Domain Number - Region: 32-81
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0017
Family LacY-like proton/sugar symporter 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 554290.SSPA2065
Sequence length 150
Comment (Salmonella enterica serovar Paratyphi A AKU 12601)
Sequence
MIAMILVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLTVWLLPLGWEWQGVLF
AALTLLAAWLWWRWLARRVREQKPTDSRLNQRGQQLIGRRFMLDAALVNGRGHMRVGDSS
WPVCADEDLRAGTHVEVIAVEGITLRIRAV
Download sequence
Identical sequences A0A0H2WQX2 A0A2J1A3J7
gi|197363265|ref|YP_002142902.1| 295319.SPA2222 554290.SSPA2065 gi|56414345|ref|YP_151420.1| CP000026|CDS_2311640-2312092 FM200053|CDS_2306824-2307276 WP_000561174.1.101111 WP_000561174.1.101239 WP_000561174.1.101904 WP_000561174.1.11810 WP_000561174.1.12210 WP_000561174.1.12308 WP_000561174.1.12865 WP_000561174.1.13262 WP_000561174.1.13602 WP_000561174.1.13967 WP_000561174.1.15011 WP_000561174.1.15938 WP_000561174.1.16710 WP_000561174.1.18355 WP_000561174.1.19882 WP_000561174.1.20564 WP_000561174.1.2139 WP_000561174.1.21534 WP_000561174.1.22451 WP_000561174.1.22566 WP_000561174.1.24394 WP_000561174.1.25846 WP_000561174.1.26122 WP_000561174.1.26750 WP_000561174.1.30555 WP_000561174.1.31069 WP_000561174.1.31546 WP_000561174.1.329 WP_000561174.1.33420 WP_000561174.1.33504 WP_000561174.1.34424 WP_000561174.1.35331 WP_000561174.1.35507 WP_000561174.1.36057 WP_000561174.1.36586 WP_000561174.1.36875 WP_000561174.1.38452 WP_000561174.1.38620 WP_000561174.1.39112 WP_000561174.1.39953 WP_000561174.1.40031 WP_000561174.1.40688 WP_000561174.1.42098 WP_000561174.1.4229 WP_000561174.1.42372 WP_000561174.1.44144 WP_000561174.1.44606 WP_000561174.1.44687 WP_000561174.1.4505 WP_000561174.1.47023 WP_000561174.1.47061 WP_000561174.1.47110 WP_000561174.1.47243 WP_000561174.1.47542 WP_000561174.1.47660 WP_000561174.1.48134 WP_000561174.1.48510 WP_000561174.1.48768 WP_000561174.1.48841 WP_000561174.1.49430 WP_000561174.1.49494 WP_000561174.1.49790 WP_000561174.1.50153 WP_000561174.1.50529 WP_000561174.1.50750 WP_000561174.1.5185 WP_000561174.1.52101 WP_000561174.1.54340 WP_000561174.1.5462 WP_000561174.1.55200 WP_000561174.1.56070 WP_000561174.1.56374 WP_000561174.1.56791 WP_000561174.1.56942 WP_000561174.1.57244 WP_000561174.1.5761 WP_000561174.1.58467 WP_000561174.1.59068 WP_000561174.1.59276 WP_000561174.1.60809 WP_000561174.1.61309 WP_000561174.1.6143 WP_000561174.1.61694 WP_000561174.1.62063 WP_000561174.1.62195 WP_000561174.1.64758 WP_000561174.1.65475 WP_000561174.1.65818 WP_000561174.1.65945 WP_000561174.1.67228 WP_000561174.1.67825 WP_000561174.1.69433 WP_000561174.1.69839 WP_000561174.1.7060 WP_000561174.1.70662 WP_000561174.1.71656 WP_000561174.1.71848 WP_000561174.1.72121 WP_000561174.1.72254 WP_000561174.1.72797 WP_000561174.1.72946 WP_000561174.1.73102 WP_000561174.1.73958 WP_000561174.1.74741 WP_000561174.1.75371 WP_000561174.1.76115 WP_000561174.1.7784 WP_000561174.1.78352 WP_000561174.1.78959 WP_000561174.1.79531 WP_000561174.1.79977 WP_000561174.1.80045 WP_000561174.1.81041 WP_000561174.1.81084 WP_000561174.1.81568 WP_000561174.1.81798 WP_000561174.1.82692 WP_000561174.1.83280 WP_000561174.1.83806 WP_000561174.1.84814 WP_000561174.1.84872 WP_000561174.1.84879 WP_000561174.1.86466 WP_000561174.1.87220 WP_000561174.1.87276 WP_000561174.1.87376 WP_000561174.1.87651 WP_000561174.1.87891 WP_000561174.1.88817 WP_000561174.1.89764 WP_000561174.1.91282 WP_000561174.1.91312 WP_000561174.1.91331 WP_000561174.1.9166 WP_000561174.1.91984 WP_000561174.1.92646 WP_000561174.1.92786 WP_000561174.1.92842 WP_000561174.1.92936 WP_000561174.1.93118 WP_000561174.1.94071 WP_000561174.1.95133 WP_000561174.1.96731 WP_000561174.1.99073 WP_000561174.1.99531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]