SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 557600.ABBFA_000712 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  557600.ABBFA_000712
Domain Number 1 Region: 86-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000144
Family NfeD domain-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 557600.ABBFA_000712
Sequence length 153
Comment (Acinetobacter baumannii AB307 0294)
Sequence
MEFVVEPWHWFVLGILLILSELILPAFAALWFGIAAIMVCFLYWLFPDISLTTQIVLWIV
LSVLCTLLWFKFIKPLSIDKTKAGLPREATIGQIGMVIQTGLAHDQIIVRFPMPILGADE
WNCRSTTPVKVGDRVRVIDISGNDLIVQPHSTS
Download sequence
Identical sequences A0A009HU20 A0A009K2F1 A0A009PFQ1 A0A062EUU5 A0A062FHF3 A0A062MN55 A0A0E1PU04 A0A0J0ZQB4 A0A0R1C4J4 A0A158LWQ8 A0A171F106 B0VEL3 D0CDN1 G2JM97 L9P3T1 N8ZIC2 N9I5M6 V5VBS8
gi|215482443|ref|YP_002324629.1| gi|184159329|ref|YP_001847668.1| gi|523524476|ref|YP_008210555.1| gi|213157700|ref|YP_002320498.1| gi|169794896|ref|YP_001712689.1| gi|565637285|ref|YP_008889528.1| gi|407933913|ref|YP_006849556.1| gi|385238768|ref|YP_005800107.1| HMPREF0010_02861T0 gi|387122751|ref|YP_006288633.1| gi|523528269|ref|YP_008214300.1| WP_000397562.1.100119 WP_000397562.1.100136 WP_000397562.1.100152 WP_000397562.1.100157 WP_000397562.1.100211 WP_000397562.1.100222 WP_000397562.1.100225 WP_000397562.1.100238 WP_000397562.1.100290 WP_000397562.1.1003 WP_000397562.1.100380 WP_000397562.1.100406 WP_000397562.1.100568 WP_000397562.1.10058 WP_000397562.1.100616 WP_000397562.1.100656 WP_000397562.1.100864 WP_000397562.1.100957 WP_000397562.1.100971 WP_000397562.1.101001 WP_000397562.1.101005 WP_000397562.1.101012 WP_000397562.1.101037 WP_000397562.1.101100 WP_000397562.1.101243 WP_000397562.1.101254 WP_000397562.1.101258 WP_000397562.1.101276 WP_000397562.1.101338 WP_000397562.1.10136 WP_000397562.1.1014 WP_000397562.1.101409 WP_000397562.1.101413 WP_000397562.1.10147 WP_000397562.1.101515 WP_000397562.1.101574 WP_000397562.1.101742 WP_000397562.1.101810 WP_000397562.1.101850 WP_000397562.1.101885 WP_000397562.1.101910 WP_000397562.1.101976 WP_000397562.1.101995 WP_000397562.1.102023 WP_000397562.1.102110 WP_000397562.1.10256 WP_000397562.1.10328 WP_000397562.1.10375 WP_000397562.1.10466 WP_000397562.1.10512 WP_000397562.1.10649 WP_000397562.1.10725 WP_000397562.1.10768 WP_000397562.1.10777 WP_000397562.1.1080 WP_000397562.1.10838 WP_000397562.1.10852 WP_000397562.1.10909 WP_000397562.1.11003 WP_000397562.1.1101 WP_000397562.1.11016 WP_000397562.1.11090 WP_000397562.1.11203 WP_000397562.1.11305 WP_000397562.1.11307 WP_000397562.1.11308 WP_000397562.1.11374 WP_000397562.1.1138 WP_000397562.1.1155 WP_000397562.1.11698 WP_000397562.1.11910 WP_000397562.1.11923 WP_000397562.1.11925 WP_000397562.1.11926 WP_000397562.1.11989 WP_000397562.1.1216 WP_000397562.1.12250 WP_000397562.1.12322 WP_000397562.1.12358 WP_000397562.1.12414 WP_000397562.1.12529 WP_000397562.1.12617 WP_000397562.1.1270 WP_000397562.1.12702 WP_000397562.1.12796 WP_000397562.1.12818 WP_000397562.1.1283 WP_000397562.1.12912 WP_000397562.1.12974 WP_000397562.1.13047 WP_000397562.1.13078 WP_000397562.1.13109 WP_000397562.1.13124 WP_000397562.1.13137 WP_000397562.1.1317 WP_000397562.1.13195 WP_000397562.1.13220 WP_000397562.1.13236 WP_000397562.1.13480 WP_000397562.1.13485 WP_000397562.1.13516 WP_000397562.1.13521 WP_000397562.1.13635 WP_000397562.1.13651 WP_000397562.1.13675 WP_000397562.1.13699 WP_000397562.1.13761 WP_000397562.1.13788 WP_000397562.1.13821 WP_000397562.1.13850 WP_000397562.1.13871 WP_000397562.1.13894 WP_000397562.1.1390 WP_000397562.1.13916 WP_000397562.1.1396 WP_000397562.1.14020 WP_000397562.1.1411 WP_000397562.1.14187 WP_000397562.1.14271 WP_000397562.1.14293 WP_000397562.1.14354 WP_000397562.1.14357 WP_000397562.1.14385 WP_000397562.1.14392 WP_000397562.1.14479 WP_000397562.1.14515 WP_000397562.1.14650 WP_000397562.1.14700 WP_000397562.1.14801 WP_000397562.1.14829 WP_000397562.1.14853 WP_000397562.1.14854 WP_000397562.1.14909 WP_000397562.1.14939 WP_000397562.1.15066 WP_000397562.1.15152 WP_000397562.1.15166 WP_000397562.1.15289 WP_000397562.1.15383 WP_000397562.1.15428 WP_000397562.1.15462 WP_000397562.1.15465 WP_000397562.1.15497 WP_000397562.1.15651 WP_000397562.1.15653 WP_000397562.1.15656 WP_000397562.1.15695 WP_000397562.1.15713 WP_000397562.1.15778 WP_000397562.1.15793 WP_000397562.1.15821 WP_000397562.1.15947 WP_000397562.1.16011 WP_000397562.1.16178 WP_000397562.1.16202 WP_000397562.1.16288 WP_000397562.1.16325 WP_000397562.1.16343 WP_000397562.1.16371 WP_000397562.1.1639 WP_000397562.1.16398 WP_000397562.1.16411 WP_000397562.1.16434 WP_000397562.1.16510 WP_000397562.1.1656 WP_000397562.1.16576 WP_000397562.1.16579 WP_000397562.1.1658 WP_000397562.1.16607 WP_000397562.1.16610 WP_000397562.1.16699 WP_000397562.1.16701 WP_000397562.1.16717 WP_000397562.1.16760 WP_000397562.1.16787 WP_000397562.1.16850 WP_000397562.1.16864 WP_000397562.1.16993 WP_000397562.1.17002 WP_000397562.1.17021 WP_000397562.1.17097 WP_000397562.1.17244 WP_000397562.1.17414 WP_000397562.1.17433 WP_000397562.1.17468 WP_000397562.1.17492 WP_000397562.1.1753 WP_000397562.1.17632 WP_000397562.1.17646 WP_000397562.1.17664 WP_000397562.1.17752 WP_000397562.1.17781 WP_000397562.1.17999 WP_000397562.1.18082 WP_000397562.1.18091 WP_000397562.1.18238 WP_000397562.1.18286 WP_000397562.1.18302 WP_000397562.1.18325 WP_000397562.1.18385 WP_000397562.1.18546 WP_000397562.1.18701 WP_000397562.1.18755 WP_000397562.1.19092 WP_000397562.1.1910 WP_000397562.1.19120 WP_000397562.1.19131 WP_000397562.1.1916 WP_000397562.1.19168 WP_000397562.1.19292 WP_000397562.1.19339 WP_000397562.1.19396 WP_000397562.1.19475 WP_000397562.1.19670 WP_000397562.1.19826 WP_000397562.1.19877 WP_000397562.1.1995 WP_000397562.1.20044 WP_000397562.1.20066 WP_000397562.1.20120 WP_000397562.1.20176 WP_000397562.1.20194 WP_000397562.1.20306 WP_000397562.1.2033 WP_000397562.1.20359 WP_000397562.1.2039 WP_000397562.1.20444 WP_000397562.1.20534 WP_000397562.1.20541 WP_000397562.1.20571 WP_000397562.1.20656 WP_000397562.1.20748 WP_000397562.1.20807 WP_000397562.1.20816 WP_000397562.1.20817 WP_000397562.1.20830 WP_000397562.1.20889 WP_000397562.1.20987 WP_000397562.1.20998 WP_000397562.1.21032 WP_000397562.1.21112 WP_000397562.1.21117 WP_000397562.1.21167 WP_000397562.1.21190 WP_000397562.1.21264 WP_000397562.1.21337 WP_000397562.1.21484 WP_000397562.1.21546 WP_000397562.1.21662 WP_000397562.1.21689 WP_000397562.1.21738 WP_000397562.1.21747 WP_000397562.1.21939 WP_000397562.1.22047 WP_000397562.1.22053 WP_000397562.1.2215 WP_000397562.1.22209 WP_000397562.1.22286 WP_000397562.1.22301 WP_000397562.1.22349 WP_000397562.1.22396 WP_000397562.1.22452 WP_000397562.1.22469 WP_000397562.1.22515 WP_000397562.1.22586 WP_000397562.1.22687 WP_000397562.1.23023 WP_000397562.1.23141 WP_000397562.1.23173 WP_000397562.1.23188 WP_000397562.1.23234 WP_000397562.1.23243 WP_000397562.1.23328 WP_000397562.1.23401 WP_000397562.1.23636 WP_000397562.1.23651 WP_000397562.1.23669 WP_000397562.1.23674 WP_000397562.1.23821 WP_000397562.1.2386 WP_000397562.1.23975 WP_000397562.1.23997 WP_000397562.1.24015 WP_000397562.1.24041 WP_000397562.1.24097 WP_000397562.1.24105 WP_000397562.1.24152 WP_000397562.1.24178 WP_000397562.1.24260 WP_000397562.1.24292 WP_000397562.1.24358 WP_000397562.1.24373 WP_000397562.1.24449 WP_000397562.1.2445 WP_000397562.1.24545 WP_000397562.1.24586 WP_000397562.1.24611 WP_000397562.1.24621 WP_000397562.1.24706 WP_000397562.1.24744 WP_000397562.1.2475 WP_000397562.1.24750 WP_000397562.1.24916 WP_000397562.1.24927 WP_000397562.1.25091 WP_000397562.1.25131 WP_000397562.1.25143 WP_000397562.1.25263 WP_000397562.1.25292 WP_000397562.1.25478 WP_000397562.1.25519 WP_000397562.1.25524 WP_000397562.1.25560 WP_000397562.1.25588 WP_000397562.1.2559 WP_000397562.1.2561 WP_000397562.1.25638 WP_000397562.1.25689 WP_000397562.1.25723 WP_000397562.1.2585 WP_000397562.1.25850 WP_000397562.1.25971 WP_000397562.1.26181 WP_000397562.1.26204 WP_000397562.1.2626 WP_000397562.1.26352 WP_000397562.1.26425 WP_000397562.1.26436 WP_000397562.1.26472 WP_000397562.1.26504 WP_000397562.1.26528 WP_000397562.1.26647 WP_000397562.1.26649 WP_000397562.1.26669 WP_000397562.1.26678 WP_000397562.1.26715 WP_000397562.1.26744 WP_000397562.1.26921 WP_000397562.1.26946 WP_000397562.1.27059 WP_000397562.1.27109 WP_000397562.1.27176 WP_000397562.1.2722 WP_000397562.1.27220 WP_000397562.1.27265 WP_000397562.1.27270 WP_000397562.1.273 WP_000397562.1.2730 WP_000397562.1.27346 WP_000397562.1.2736 WP_000397562.1.2738 WP_000397562.1.27506 WP_000397562.1.27509 WP_000397562.1.2762 WP_000397562.1.27656 WP_000397562.1.2769 WP_000397562.1.27704 WP_000397562.1.27731 WP_000397562.1.27801 WP_000397562.1.27840 WP_000397562.1.27845 WP_000397562.1.27852 WP_000397562.1.27934 WP_000397562.1.27983 WP_000397562.1.28048 WP_000397562.1.28101 WP_000397562.1.28141 WP_000397562.1.28204 WP_000397562.1.28236 WP_000397562.1.28320 WP_000397562.1.28385 WP_000397562.1.28405 WP_000397562.1.28411 WP_000397562.1.28456 WP_000397562.1.28507 WP_000397562.1.28513 WP_000397562.1.28581 WP_000397562.1.28601 WP_000397562.1.28677 WP_000397562.1.28689 WP_000397562.1.28774 WP_000397562.1.28883 WP_000397562.1.28898 WP_000397562.1.28937 WP_000397562.1.28988 WP_000397562.1.29047 WP_000397562.1.29074 WP_000397562.1.29117 WP_000397562.1.29123 WP_000397562.1.29216 WP_000397562.1.29229 WP_000397562.1.29347 WP_000397562.1.29362 WP_000397562.1.29434 WP_000397562.1.29455 WP_000397562.1.29461 WP_000397562.1.29552 WP_000397562.1.29672 WP_000397562.1.29779 WP_000397562.1.2979 WP_000397562.1.29806 WP_000397562.1.29817 WP_000397562.1.29824 WP_000397562.1.29897 WP_000397562.1.30026 WP_000397562.1.30083 WP_000397562.1.30161 WP_000397562.1.30173 WP_000397562.1.30309 WP_000397562.1.30407 WP_000397562.1.30466 WP_000397562.1.30490 WP_000397562.1.30498 WP_000397562.1.30597 WP_000397562.1.30611 WP_000397562.1.30667 WP_000397562.1.30673 WP_000397562.1.3075 WP_000397562.1.30776 WP_000397562.1.30856 WP_000397562.1.30932 WP_000397562.1.30969 WP_000397562.1.30978 WP_000397562.1.30996 WP_000397562.1.31121 WP_000397562.1.31141 WP_000397562.1.3116 WP_000397562.1.31328 WP_000397562.1.31345 WP_000397562.1.31430 WP_000397562.1.3144 WP_000397562.1.3162 WP_000397562.1.3163 WP_000397562.1.31729 WP_000397562.1.31810 WP_000397562.1.31834 WP_000397562.1.3198 WP_000397562.1.31980 WP_000397562.1.32028 WP_000397562.1.32065 WP_000397562.1.32129 WP_000397562.1.3225 WP_000397562.1.32257 WP_000397562.1.32272 WP_000397562.1.32304 WP_000397562.1.32374 WP_000397562.1.32386 WP_000397562.1.32487 WP_000397562.1.32532 WP_000397562.1.32579 WP_000397562.1.32682 WP_000397562.1.32773 WP_000397562.1.3280 WP_000397562.1.32830 WP_000397562.1.32847 WP_000397562.1.32956 WP_000397562.1.32983 WP_000397562.1.3303 WP_000397562.1.33104 WP_000397562.1.33154 WP_000397562.1.33198 WP_000397562.1.33262 WP_000397562.1.33308 WP_000397562.1.33370 WP_000397562.1.33386 WP_000397562.1.33447 WP_000397562.1.3346 WP_000397562.1.33495 WP_000397562.1.33541 WP_000397562.1.33558 WP_000397562.1.33679 WP_000397562.1.33706 WP_000397562.1.33714 WP_000397562.1.33777 WP_000397562.1.33805 WP_000397562.1.33869 WP_000397562.1.33871 WP_000397562.1.33902 WP_000397562.1.33929 WP_000397562.1.33931 WP_000397562.1.33978 WP_000397562.1.33999 WP_000397562.1.34027 WP_000397562.1.34045 WP_000397562.1.34049 WP_000397562.1.34207 WP_000397562.1.34394 WP_000397562.1.34618 WP_000397562.1.34642 WP_000397562.1.34859 WP_000397562.1.35000 WP_000397562.1.35018 WP_000397562.1.35046 WP_000397562.1.35242 WP_000397562.1.35250 WP_000397562.1.35327 WP_000397562.1.3535 WP_000397562.1.35434 WP_000397562.1.35461 WP_000397562.1.35558 WP_000397562.1.35588 WP_000397562.1.35601 WP_000397562.1.35715 WP_000397562.1.35717 WP_000397562.1.35728 WP_000397562.1.35758 WP_000397562.1.35761 WP_000397562.1.35828 WP_000397562.1.35883 WP_000397562.1.35912 WP_000397562.1.3592 WP_000397562.1.36122 WP_000397562.1.36327 WP_000397562.1.36355 WP_000397562.1.36358 WP_000397562.1.36359 WP_000397562.1.36381 WP_000397562.1.36418 WP_000397562.1.36517 WP_000397562.1.36549 WP_000397562.1.36569 WP_000397562.1.36694 WP_000397562.1.36714 WP_000397562.1.36735 WP_000397562.1.36866 WP_000397562.1.36869 WP_000397562.1.36882 WP_000397562.1.36909 WP_000397562.1.36938 WP_000397562.1.3712 WP_000397562.1.37180 WP_000397562.1.37215 WP_000397562.1.37345 WP_000397562.1.37386 WP_000397562.1.37437 WP_000397562.1.3755 WP_000397562.1.3758 WP_000397562.1.37603 WP_000397562.1.37607 WP_000397562.1.37680 WP_000397562.1.37729 WP_000397562.1.37803 WP_000397562.1.37893 WP_000397562.1.37963 WP_000397562.1.37982 WP_000397562.1.38009 WP_000397562.1.38122 WP_000397562.1.38249 WP_000397562.1.38320 WP_000397562.1.3837 WP_000397562.1.3843 WP_000397562.1.3856 WP_000397562.1.3861 WP_000397562.1.38628 WP_000397562.1.38689 WP_000397562.1.38696 WP_000397562.1.38732 WP_000397562.1.38748 WP_000397562.1.38758 WP_000397562.1.38779 WP_000397562.1.38883 WP_000397562.1.38901 WP_000397562.1.38964 WP_000397562.1.39019 WP_000397562.1.39159 WP_000397562.1.39353 WP_000397562.1.39399 WP_000397562.1.39598 WP_000397562.1.39680 WP_000397562.1.39688 WP_000397562.1.397 WP_000397562.1.3974 WP_000397562.1.39799 WP_000397562.1.39901 WP_000397562.1.39911 WP_000397562.1.39927 WP_000397562.1.39928 WP_000397562.1.40199 WP_000397562.1.40200 WP_000397562.1.40225 WP_000397562.1.40233 WP_000397562.1.40297 WP_000397562.1.40332 WP_000397562.1.4047 WP_000397562.1.40490 WP_000397562.1.40497 WP_000397562.1.40547 WP_000397562.1.40645 WP_000397562.1.40679 WP_000397562.1.40762 WP_000397562.1.40832 WP_000397562.1.40836 WP_000397562.1.4086 WP_000397562.1.40864 WP_000397562.1.40947 WP_000397562.1.41029 WP_000397562.1.41059 WP_000397562.1.4110 WP_000397562.1.41201 WP_000397562.1.41266 WP_000397562.1.41395 WP_000397562.1.41425 WP_000397562.1.41507 WP_000397562.1.41546 WP_000397562.1.4164 WP_000397562.1.41707 WP_000397562.1.41720 WP_000397562.1.41738 WP_000397562.1.41777 WP_000397562.1.41838 WP_000397562.1.41878 WP_000397562.1.41922 WP_000397562.1.41934 WP_000397562.1.41936 WP_000397562.1.42080 WP_000397562.1.42172 WP_000397562.1.42253 WP_000397562.1.42289 WP_000397562.1.42351 WP_000397562.1.42401 WP_000397562.1.42484 WP_000397562.1.42531 WP_000397562.1.42561 WP_000397562.1.42571 WP_000397562.1.42581 WP_000397562.1.42708 WP_000397562.1.42721 WP_000397562.1.42765 WP_000397562.1.4277 WP_000397562.1.42773 WP_000397562.1.4281 WP_000397562.1.42824 WP_000397562.1.42888 WP_000397562.1.42928 WP_000397562.1.43011 WP_000397562.1.43028 WP_000397562.1.43088 WP_000397562.1.43094 WP_000397562.1.431 WP_000397562.1.4311 WP_000397562.1.43175 WP_000397562.1.43194 WP_000397562.1.43203 WP_000397562.1.43227 WP_000397562.1.43340 WP_000397562.1.43439 WP_000397562.1.43641 WP_000397562.1.43645 WP_000397562.1.43672 WP_000397562.1.43751 WP_000397562.1.43755 WP_000397562.1.43759 WP_000397562.1.43766 WP_000397562.1.4396 WP_000397562.1.43978 WP_000397562.1.44009 WP_000397562.1.44058 WP_000397562.1.44275 WP_000397562.1.44342 WP_000397562.1.44370 WP_000397562.1.44372 WP_000397562.1.44385 WP_000397562.1.44407 WP_000397562.1.44613 WP_000397562.1.44664 WP_000397562.1.44684 WP_000397562.1.44770 WP_000397562.1.44809 WP_000397562.1.44816 WP_000397562.1.4484 WP_000397562.1.44886 WP_000397562.1.44926 WP_000397562.1.44929 WP_000397562.1.44944 WP_000397562.1.44964 WP_000397562.1.44974 WP_000397562.1.44991 WP_000397562.1.45149 WP_000397562.1.45212 WP_000397562.1.45233 WP_000397562.1.45239 WP_000397562.1.45291 WP_000397562.1.45307 WP_000397562.1.45350 WP_000397562.1.4537 WP_000397562.1.45399 WP_000397562.1.45418 WP_000397562.1.45457 WP_000397562.1.4548 WP_000397562.1.45587 WP_000397562.1.45608 WP_000397562.1.45637 WP_000397562.1.45647 WP_000397562.1.45675 WP_000397562.1.45761 WP_000397562.1.45839 WP_000397562.1.45916 WP_000397562.1.45966 WP_000397562.1.46080 WP_000397562.1.46108 WP_000397562.1.46126 WP_000397562.1.46138 WP_000397562.1.46194 WP_000397562.1.46224 WP_000397562.1.46246 WP_000397562.1.46255 WP_000397562.1.46258 WP_000397562.1.46338 WP_000397562.1.46385 WP_000397562.1.46392 WP_000397562.1.46413 WP_000397562.1.46474 WP_000397562.1.4648 WP_000397562.1.46493 WP_000397562.1.46518 WP_000397562.1.46553 WP_000397562.1.46577 WP_000397562.1.46739 WP_000397562.1.46762 WP_000397562.1.46774 WP_000397562.1.46827 WP_000397562.1.4683 WP_000397562.1.46850 WP_000397562.1.46887 WP_000397562.1.46896 WP_000397562.1.46918 WP_000397562.1.46950 WP_000397562.1.46959 WP_000397562.1.47141 WP_000397562.1.47241 WP_000397562.1.47298 WP_000397562.1.47388 WP_000397562.1.47436 WP_000397562.1.47515 WP_000397562.1.47543 WP_000397562.1.47552 WP_000397562.1.47553 WP_000397562.1.47573 WP_000397562.1.47607 WP_000397562.1.47715 WP_000397562.1.47816 WP_000397562.1.47828 WP_000397562.1.47863 WP_000397562.1.47903 WP_000397562.1.47917 WP_000397562.1.47937 WP_000397562.1.48042 WP_000397562.1.48115 WP_000397562.1.4819 WP_000397562.1.4824 WP_000397562.1.48270 WP_000397562.1.48280 WP_000397562.1.48380 WP_000397562.1.48415 WP_000397562.1.48457 WP_000397562.1.48495 WP_000397562.1.48509 WP_000397562.1.48527 WP_000397562.1.48529 WP_000397562.1.4855 WP_000397562.1.48642 WP_000397562.1.48692 WP_000397562.1.48700 WP_000397562.1.48785 WP_000397562.1.48824 WP_000397562.1.4887 WP_000397562.1.489 WP_000397562.1.48925 WP_000397562.1.48977 WP_000397562.1.48988 WP_000397562.1.49083 WP_000397562.1.4911 WP_000397562.1.49261 WP_000397562.1.49318 WP_000397562.1.4935 WP_000397562.1.49380 WP_000397562.1.49405 WP_000397562.1.4941 WP_000397562.1.49463 WP_000397562.1.49564 WP_000397562.1.49639 WP_000397562.1.4967 WP_000397562.1.49673 WP_000397562.1.49705 WP_000397562.1.49789 WP_000397562.1.49866 WP_000397562.1.49896 WP_000397562.1.49928 WP_000397562.1.49938 WP_000397562.1.49960 WP_000397562.1.49992 WP_000397562.1.5 WP_000397562.1.50011 WP_000397562.1.50097 WP_000397562.1.50111 WP_000397562.1.50150 WP_000397562.1.50208 WP_000397562.1.50216 WP_000397562.1.50220 WP_000397562.1.50223 WP_000397562.1.50267 WP_000397562.1.50298 WP_000397562.1.503 WP_000397562.1.50617 WP_000397562.1.50641 WP_000397562.1.50705 WP_000397562.1.50789 WP_000397562.1.50807 WP_000397562.1.50815 WP_000397562.1.50851 WP_000397562.1.50859 WP_000397562.1.50867 WP_000397562.1.50872 WP_000397562.1.51063 WP_000397562.1.51303 WP_000397562.1.51314 WP_000397562.1.51328 WP_000397562.1.51369 WP_000397562.1.51378 WP_000397562.1.51437 WP_000397562.1.51569 WP_000397562.1.51578 WP_000397562.1.51597 WP_000397562.1.51640 WP_000397562.1.51663 WP_000397562.1.51709 WP_000397562.1.5171 WP_000397562.1.51856 WP_000397562.1.51861 WP_000397562.1.5193 WP_000397562.1.51966 WP_000397562.1.52030 WP_000397562.1.52032 WP_000397562.1.5206 WP_000397562.1.52103 WP_000397562.1.52138 WP_000397562.1.52189 WP_000397562.1.5220 WP_000397562.1.52325 WP_000397562.1.52342 WP_000397562.1.52392 WP_000397562.1.52445 WP_000397562.1.52619 WP_000397562.1.5274 WP_000397562.1.52766 WP_000397562.1.52769 WP_000397562.1.52779 WP_000397562.1.5281 WP_000397562.1.52837 WP_000397562.1.52839 WP_000397562.1.52840 WP_000397562.1.52885 WP_000397562.1.52980 WP_000397562.1.52982 WP_000397562.1.53023 WP_000397562.1.53052 WP_000397562.1.53076 WP_000397562.1.53097 WP_000397562.1.53146 WP_000397562.1.53331 WP_000397562.1.53390 WP_000397562.1.53424 WP_000397562.1.53498 WP_000397562.1.53533 WP_000397562.1.53539 WP_000397562.1.53593 WP_000397562.1.53616 WP_000397562.1.53708 WP_000397562.1.53762 WP_000397562.1.53854 WP_000397562.1.53954 WP_000397562.1.53965 WP_000397562.1.54 WP_000397562.1.54055 WP_000397562.1.54088 WP_000397562.1.54108 WP_000397562.1.5412 WP_000397562.1.54138 WP_000397562.1.54139 WP_000397562.1.54242 WP_000397562.1.54266 WP_000397562.1.54352 WP_000397562.1.54361 WP_000397562.1.54451 WP_000397562.1.54464 WP_000397562.1.54492 WP_000397562.1.54566 WP_000397562.1.54581 WP_000397562.1.54664 WP_000397562.1.54718 WP_000397562.1.54741 WP_000397562.1.54761 WP_000397562.1.54885 WP_000397562.1.5489 WP_000397562.1.54963 WP_000397562.1.54977 WP_000397562.1.55062 WP_000397562.1.55096 WP_000397562.1.55155 WP_000397562.1.55201 WP_000397562.1.55321 WP_000397562.1.55363 WP_000397562.1.55368 WP_000397562.1.55376 WP_000397562.1.55408 WP_000397562.1.55447 WP_000397562.1.55491 WP_000397562.1.55516 WP_000397562.1.55631 WP_000397562.1.55638 WP_000397562.1.55799 WP_000397562.1.55952 WP_000397562.1.55997 WP_000397562.1.56027 WP_000397562.1.56067 WP_000397562.1.56076 WP_000397562.1.56102 WP_000397562.1.56154 WP_000397562.1.56165 WP_000397562.1.56211 WP_000397562.1.56246 WP_000397562.1.56379 WP_000397562.1.56538 WP_000397562.1.56668 WP_000397562.1.56690 WP_000397562.1.56712 WP_000397562.1.56717 WP_000397562.1.56798 WP_000397562.1.56833 WP_000397562.1.56841 WP_000397562.1.5697 WP_000397562.1.56991 WP_000397562.1.57078 WP_000397562.1.57250 WP_000397562.1.57346 WP_000397562.1.57408 WP_000397562.1.57457 WP_000397562.1.57465 WP_000397562.1.57535 WP_000397562.1.57543 WP_000397562.1.57606 WP_000397562.1.57654 WP_000397562.1.5769 WP_000397562.1.57731 WP_000397562.1.5780 WP_000397562.1.57829 WP_000397562.1.57874 WP_000397562.1.57987 WP_000397562.1.58061 WP_000397562.1.58115 WP_000397562.1.5822 WP_000397562.1.58269 WP_000397562.1.58319 WP_000397562.1.58337 WP_000397562.1.58453 WP_000397562.1.58503 WP_000397562.1.58506 WP_000397562.1.58621 WP_000397562.1.58802 WP_000397562.1.58969 WP_000397562.1.590 WP_000397562.1.59078 WP_000397562.1.5908 WP_000397562.1.59107 WP_000397562.1.59232 WP_000397562.1.59325 WP_000397562.1.59416 WP_000397562.1.59417 WP_000397562.1.59450 WP_000397562.1.59456 WP_000397562.1.59476 WP_000397562.1.59488 WP_000397562.1.59522 WP_000397562.1.5961 WP_000397562.1.59649 WP_000397562.1.59754 WP_000397562.1.59765 WP_000397562.1.59897 WP_000397562.1.59944 WP_000397562.1.59957 WP_000397562.1.600 WP_000397562.1.60099 WP_000397562.1.60108 WP_000397562.1.60109 WP_000397562.1.60116 WP_000397562.1.60144 WP_000397562.1.60176 WP_000397562.1.60198 WP_000397562.1.60243 WP_000397562.1.60299 WP_000397562.1.60318 WP_000397562.1.60359 WP_000397562.1.60474 WP_000397562.1.60484 WP_000397562.1.60542 WP_000397562.1.60546 WP_000397562.1.60581 WP_000397562.1.60589 WP_000397562.1.60609 WP_000397562.1.60616 WP_000397562.1.60655 WP_000397562.1.60669 WP_000397562.1.60678 WP_000397562.1.60697 WP_000397562.1.60933 WP_000397562.1.61105 WP_000397562.1.61291 WP_000397562.1.61336 WP_000397562.1.61410 WP_000397562.1.61441 WP_000397562.1.61452 WP_000397562.1.61477 WP_000397562.1.61527 WP_000397562.1.61578 WP_000397562.1.61637 WP_000397562.1.61704 WP_000397562.1.61759 WP_000397562.1.61974 WP_000397562.1.62011 WP_000397562.1.62032 WP_000397562.1.62067 WP_000397562.1.62150 WP_000397562.1.62191 WP_000397562.1.6221 WP_000397562.1.62242 WP_000397562.1.62308 WP_000397562.1.62368 WP_000397562.1.624 WP_000397562.1.62428 WP_000397562.1.62435 WP_000397562.1.62543 WP_000397562.1.6257 WP_000397562.1.62712 WP_000397562.1.62767 WP_000397562.1.6277 WP_000397562.1.62817 WP_000397562.1.62868 WP_000397562.1.6289 WP_000397562.1.62924 WP_000397562.1.62935 WP_000397562.1.63028 WP_000397562.1.63219 WP_000397562.1.63224 WP_000397562.1.63252 WP_000397562.1.63274 WP_000397562.1.63303 WP_000397562.1.63340 WP_000397562.1.63344 WP_000397562.1.63354 WP_000397562.1.63391 WP_000397562.1.63405 WP_000397562.1.63426 WP_000397562.1.63429 WP_000397562.1.6352 WP_000397562.1.63537 WP_000397562.1.63609 WP_000397562.1.63636 WP_000397562.1.63639 WP_000397562.1.63649 WP_000397562.1.63681 WP_000397562.1.63796 WP_000397562.1.63857 WP_000397562.1.63906 WP_000397562.1.63933 WP_000397562.1.64044 WP_000397562.1.64177 WP_000397562.1.64214 WP_000397562.1.64218 WP_000397562.1.64231 WP_000397562.1.64310 WP_000397562.1.64428 WP_000397562.1.64465 WP_000397562.1.6458 WP_000397562.1.64586 WP_000397562.1.64604 WP_000397562.1.64610 WP_000397562.1.64639 WP_000397562.1.64646 WP_000397562.1.64658 WP_000397562.1.64834 WP_000397562.1.64907 WP_000397562.1.64955 WP_000397562.1.64964 WP_000397562.1.65003 WP_000397562.1.65005 WP_000397562.1.65058 WP_000397562.1.6513 WP_000397562.1.65154 WP_000397562.1.65267 WP_000397562.1.65325 WP_000397562.1.65342 WP_000397562.1.65373 WP_000397562.1.65496 WP_000397562.1.65560 WP_000397562.1.6557 WP_000397562.1.65592 WP_000397562.1.65630 WP_000397562.1.65680 WP_000397562.1.65804 WP_000397562.1.65866 WP_000397562.1.65872 WP_000397562.1.65890 WP_000397562.1.65939 WP_000397562.1.65955 WP_000397562.1.65995 WP_000397562.1.66140 WP_000397562.1.66142 WP_000397562.1.66189 WP_000397562.1.66200 WP_000397562.1.66210 WP_000397562.1.66215 WP_000397562.1.66431 WP_000397562.1.66458 WP_000397562.1.66491 WP_000397562.1.66496 WP_000397562.1.66541 WP_000397562.1.66591 WP_000397562.1.66636 WP_000397562.1.66689 WP_000397562.1.66716 WP_000397562.1.66717 WP_000397562.1.66771 WP_000397562.1.66782 WP_000397562.1.66806 WP_000397562.1.66899 WP_000397562.1.67003 WP_000397562.1.67009 WP_000397562.1.67141 WP_000397562.1.67361 WP_000397562.1.67426 WP_000397562.1.67486 WP_000397562.1.67500 WP_000397562.1.67597 WP_000397562.1.67601 WP_000397562.1.67656 WP_000397562.1.6767 WP_000397562.1.67728 WP_000397562.1.67823 WP_000397562.1.67862 WP_000397562.1.67869 WP_000397562.1.67895 WP_000397562.1.67922 WP_000397562.1.67939 WP_000397562.1.68065 WP_000397562.1.68086 WP_000397562.1.68087 WP_000397562.1.68119 WP_000397562.1.68132 WP_000397562.1.68168 WP_000397562.1.6820 WP_000397562.1.68225 WP_000397562.1.68315 WP_000397562.1.6841 WP_000397562.1.68428 WP_000397562.1.68454 WP_000397562.1.6847 WP_000397562.1.6851 WP_000397562.1.6861 WP_000397562.1.68698 WP_000397562.1.68705 WP_000397562.1.68726 WP_000397562.1.68830 WP_000397562.1.68837 WP_000397562.1.68858 WP_000397562.1.68885 WP_000397562.1.689 WP_000397562.1.68930 WP_000397562.1.69117 WP_000397562.1.69121 WP_000397562.1.69172 WP_000397562.1.69193 WP_000397562.1.69242 WP_000397562.1.69257 WP_000397562.1.69364 WP_000397562.1.69379 WP_000397562.1.69419 WP_000397562.1.69424 WP_000397562.1.69478 WP_000397562.1.6952 WP_000397562.1.69568 WP_000397562.1.69586 WP_000397562.1.69665 WP_000397562.1.69815 WP_000397562.1.69859 WP_000397562.1.69929 WP_000397562.1.69930 WP_000397562.1.70025 WP_000397562.1.70154 WP_000397562.1.70197 WP_000397562.1.70283 WP_000397562.1.70297 WP_000397562.1.70354 WP_000397562.1.70461 WP_000397562.1.70542 WP_000397562.1.70827 WP_000397562.1.70891 WP_000397562.1.70993 WP_000397562.1.71131 WP_000397562.1.71151 WP_000397562.1.71168 WP_000397562.1.71204 WP_000397562.1.71220 WP_000397562.1.71335 WP_000397562.1.71347 WP_000397562.1.71362 WP_000397562.1.71413 WP_000397562.1.71435 WP_000397562.1.71539 WP_000397562.1.71616 WP_000397562.1.71650 WP_000397562.1.71719 WP_000397562.1.7172 WP_000397562.1.71796 WP_000397562.1.71823 WP_000397562.1.71825 WP_000397562.1.71857 WP_000397562.1.71876 WP_000397562.1.71960 WP_000397562.1.71969 WP_000397562.1.71971 WP_000397562.1.72010 WP_000397562.1.72084 WP_000397562.1.7213 WP_000397562.1.72158 WP_000397562.1.72265 WP_000397562.1.72295 WP_000397562.1.72299 WP_000397562.1.72317 WP_000397562.1.72334 WP_000397562.1.72356 WP_000397562.1.72430 WP_000397562.1.7244 WP_000397562.1.72476 WP_000397562.1.72538 WP_000397562.1.72577 WP_000397562.1.72997 WP_000397562.1.73031 WP_000397562.1.73076 WP_000397562.1.73146 WP_000397562.1.73238 WP_000397562.1.73341 WP_000397562.1.73348 WP_000397562.1.73375 WP_000397562.1.73392 WP_000397562.1.73434 WP_000397562.1.73446 WP_000397562.1.73542 WP_000397562.1.73636 WP_000397562.1.73645 WP_000397562.1.73683 WP_000397562.1.73699 WP_000397562.1.73727 WP_000397562.1.73737 WP_000397562.1.73779 WP_000397562.1.73806 WP_000397562.1.73867 WP_000397562.1.73874 WP_000397562.1.73875 WP_000397562.1.73932 WP_000397562.1.74122 WP_000397562.1.74312 WP_000397562.1.74322 WP_000397562.1.74361 WP_000397562.1.74393 WP_000397562.1.74424 WP_000397562.1.74463 WP_000397562.1.7453 WP_000397562.1.74700 WP_000397562.1.74709 WP_000397562.1.74711 WP_000397562.1.74819 WP_000397562.1.74838 WP_000397562.1.74869 WP_000397562.1.74908 WP_000397562.1.74930 WP_000397562.1.74944 WP_000397562.1.74949 WP_000397562.1.74969 WP_000397562.1.75104 WP_000397562.1.75105 WP_000397562.1.75107 WP_000397562.1.75121 WP_000397562.1.75162 WP_000397562.1.7521 WP_000397562.1.75212 WP_000397562.1.75225 WP_000397562.1.75321 WP_000397562.1.75386 WP_000397562.1.75412 WP_000397562.1.75459 WP_000397562.1.75478 WP_000397562.1.75489 WP_000397562.1.75562 WP_000397562.1.75569 WP_000397562.1.75620 WP_000397562.1.75738 WP_000397562.1.75812 WP_000397562.1.75859 WP_000397562.1.75890 WP_000397562.1.75895 WP_000397562.1.75896 WP_000397562.1.75939 WP_000397562.1.76026 WP_000397562.1.7606 WP_000397562.1.76101 WP_000397562.1.76117 WP_000397562.1.76250 WP_000397562.1.76260 WP_000397562.1.76372 WP_000397562.1.76464 WP_000397562.1.76493 WP_000397562.1.7651 WP_000397562.1.76523 WP_000397562.1.76571 WP_000397562.1.76585 WP_000397562.1.76587 WP_000397562.1.7662 WP_000397562.1.76682 WP_000397562.1.76698 WP_000397562.1.76787 WP_000397562.1.76809 WP_000397562.1.76871 WP_000397562.1.76953 WP_000397562.1.76981 WP_000397562.1.77164 WP_000397562.1.77233 WP_000397562.1.77237 WP_000397562.1.77257 WP_000397562.1.77274 WP_000397562.1.77277 WP_000397562.1.77347 WP_000397562.1.77396 WP_000397562.1.77531 WP_000397562.1.77539 WP_000397562.1.77634 WP_000397562.1.77711 WP_000397562.1.77758 WP_000397562.1.77787 WP_000397562.1.77812 WP_000397562.1.77815 WP_000397562.1.77891 WP_000397562.1.77903 WP_000397562.1.7791 WP_000397562.1.77996 WP_000397562.1.78042 WP_000397562.1.78094 WP_000397562.1.78154 WP_000397562.1.7816 WP_000397562.1.78240 WP_000397562.1.7825 WP_000397562.1.78261 WP_000397562.1.78263 WP_000397562.1.78355 WP_000397562.1.78361 WP_000397562.1.78505 WP_000397562.1.7864 WP_000397562.1.7866 WP_000397562.1.78660 WP_000397562.1.78769 WP_000397562.1.78783 WP_000397562.1.78805 WP_000397562.1.78808 WP_000397562.1.78968 WP_000397562.1.78984 WP_000397562.1.79010 WP_000397562.1.79020 WP_000397562.1.79028 WP_000397562.1.79072 WP_000397562.1.79078 WP_000397562.1.7908 WP_000397562.1.79181 WP_000397562.1.79188 WP_000397562.1.79229 WP_000397562.1.79254 WP_000397562.1.79260 WP_000397562.1.79261 WP_000397562.1.79284 WP_000397562.1.793 WP_000397562.1.79328 WP_000397562.1.7938 WP_000397562.1.79405 WP_000397562.1.7949 WP_000397562.1.79513 WP_000397562.1.79567 WP_000397562.1.79701 WP_000397562.1.79720 WP_000397562.1.79728 WP_000397562.1.79736 WP_000397562.1.79774 WP_000397562.1.7978 WP_000397562.1.79789 WP_000397562.1.79889 WP_000397562.1.79909 WP_000397562.1.79938 WP_000397562.1.80092 WP_000397562.1.80121 WP_000397562.1.80125 WP_000397562.1.80138 WP_000397562.1.80143 WP_000397562.1.80162 WP_000397562.1.80195 WP_000397562.1.8021 WP_000397562.1.80347 WP_000397562.1.80528 WP_000397562.1.80585 WP_000397562.1.80655 WP_000397562.1.80665 WP_000397562.1.80712 WP_000397562.1.80730 WP_000397562.1.80766 WP_000397562.1.80887 WP_000397562.1.80897 WP_000397562.1.80905 WP_000397562.1.80987 WP_000397562.1.80989 WP_000397562.1.80997 WP_000397562.1.81002 WP_000397562.1.81068 WP_000397562.1.8108 WP_000397562.1.81161 WP_000397562.1.81240 WP_000397562.1.81253 WP_000397562.1.81294 WP_000397562.1.81319 WP_000397562.1.81345 WP_000397562.1.81373 WP_000397562.1.81412 WP_000397562.1.81441 WP_000397562.1.81466 WP_000397562.1.81468 WP_000397562.1.81700 WP_000397562.1.81704 WP_000397562.1.81764 WP_000397562.1.82036 WP_000397562.1.82039 WP_000397562.1.82040 WP_000397562.1.82082 WP_000397562.1.82090 WP_000397562.1.82110 WP_000397562.1.82203 WP_000397562.1.82235 WP_000397562.1.82286 WP_000397562.1.8230 WP_000397562.1.82355 WP_000397562.1.82366 WP_000397562.1.82453 WP_000397562.1.82504 WP_000397562.1.82538 WP_000397562.1.82561 WP_000397562.1.82633 WP_000397562.1.82786 WP_000397562.1.828 WP_000397562.1.82809 WP_000397562.1.82848 WP_000397562.1.82861 WP_000397562.1.82967 WP_000397562.1.83001 WP_000397562.1.8301 WP_000397562.1.83024 WP_000397562.1.8312 WP_000397562.1.83178 WP_000397562.1.83222 WP_000397562.1.83297 WP_000397562.1.83400 WP_000397562.1.83410 WP_000397562.1.83450 WP_000397562.1.83452 WP_000397562.1.83474 WP_000397562.1.83504 WP_000397562.1.83594 WP_000397562.1.836 WP_000397562.1.83693 WP_000397562.1.8377 WP_000397562.1.838 WP_000397562.1.83889 WP_000397562.1.83896 WP_000397562.1.839 WP_000397562.1.84012 WP_000397562.1.84034 WP_000397562.1.84058 WP_000397562.1.84099 WP_000397562.1.84139 WP_000397562.1.84171 WP_000397562.1.84189 WP_000397562.1.84247 WP_000397562.1.84250 WP_000397562.1.84308 WP_000397562.1.84318 WP_000397562.1.84332 WP_000397562.1.84387 WP_000397562.1.84447 WP_000397562.1.84490 WP_000397562.1.84527 WP_000397562.1.84536 WP_000397562.1.84550 WP_000397562.1.84571 WP_000397562.1.84618 WP_000397562.1.84688 WP_000397562.1.84691 WP_000397562.1.84706 WP_000397562.1.8472 WP_000397562.1.84769 WP_000397562.1.84864 WP_000397562.1.84898 WP_000397562.1.84921 WP_000397562.1.84944 WP_000397562.1.85149 WP_000397562.1.85168 WP_000397562.1.85185 WP_000397562.1.85299 WP_000397562.1.85359 WP_000397562.1.85364 WP_000397562.1.85449 WP_000397562.1.85468 WP_000397562.1.85472 WP_000397562.1.85493 WP_000397562.1.85544 WP_000397562.1.85616 WP_000397562.1.85683 WP_000397562.1.85711 WP_000397562.1.85716 WP_000397562.1.85743 WP_000397562.1.85833 WP_000397562.1.85846 WP_000397562.1.85865 WP_000397562.1.85889 WP_000397562.1.85922 WP_000397562.1.8596 WP_000397562.1.8601 WP_000397562.1.86131 WP_000397562.1.86163 WP_000397562.1.86180 WP_000397562.1.86242 WP_000397562.1.86277 WP_000397562.1.86385 WP_000397562.1.86536 WP_000397562.1.86715 WP_000397562.1.86869 WP_000397562.1.86890 WP_000397562.1.86908 WP_000397562.1.86922 WP_000397562.1.86966 WP_000397562.1.86973 WP_000397562.1.86976 WP_000397562.1.87048 WP_000397562.1.87099 WP_000397562.1.87111 WP_000397562.1.87312 WP_000397562.1.87319 WP_000397562.1.87432 WP_000397562.1.87545 WP_000397562.1.87567 WP_000397562.1.87598 WP_000397562.1.87688 WP_000397562.1.87727 WP_000397562.1.87746 WP_000397562.1.87805 WP_000397562.1.87830 WP_000397562.1.88040 WP_000397562.1.88093 WP_000397562.1.88109 WP_000397562.1.88115 WP_000397562.1.88131 WP_000397562.1.88133 WP_000397562.1.88163 WP_000397562.1.88183 WP_000397562.1.88512 WP_000397562.1.88596 WP_000397562.1.8860 WP_000397562.1.88613 WP_000397562.1.88654 WP_000397562.1.88842 WP_000397562.1.88851 WP_000397562.1.88956 WP_000397562.1.89172 WP_000397562.1.89199 WP_000397562.1.89209 WP_000397562.1.89218 WP_000397562.1.89289 WP_000397562.1.89376 WP_000397562.1.89383 WP_000397562.1.89410 WP_000397562.1.89419 WP_000397562.1.89459 WP_000397562.1.89484 WP_000397562.1.89568 WP_000397562.1.89611 WP_000397562.1.89643 WP_000397562.1.89653 WP_000397562.1.89685 WP_000397562.1.89790 WP_000397562.1.89792 WP_000397562.1.89836 WP_000397562.1.89876 WP_000397562.1.89878 WP_000397562.1.89906 WP_000397562.1.9008 WP_000397562.1.90087 WP_000397562.1.90118 WP_000397562.1.90132 WP_000397562.1.90262 WP_000397562.1.90310 WP_000397562.1.90362 WP_000397562.1.90375 WP_000397562.1.90378 WP_000397562.1.9038 WP_000397562.1.90399 WP_000397562.1.90413 WP_000397562.1.90656 WP_000397562.1.90697 WP_000397562.1.90704 WP_000397562.1.90743 WP_000397562.1.90755 WP_000397562.1.90781 WP_000397562.1.90795 WP_000397562.1.90932 WP_000397562.1.90945 WP_000397562.1.90953 WP_000397562.1.91085 WP_000397562.1.91147 WP_000397562.1.91206 WP_000397562.1.91241 WP_000397562.1.91249 WP_000397562.1.91286 WP_000397562.1.91335 WP_000397562.1.9134 WP_000397562.1.91355 WP_000397562.1.91442 WP_000397562.1.91477 WP_000397562.1.91502 WP_000397562.1.91523 WP_000397562.1.91612 WP_000397562.1.91696 WP_000397562.1.9172 WP_000397562.1.91752 WP_000397562.1.91754 WP_000397562.1.91762 WP_000397562.1.91780 WP_000397562.1.91789 WP_000397562.1.91832 WP_000397562.1.91854 WP_000397562.1.91906 WP_000397562.1.91908 WP_000397562.1.91941 WP_000397562.1.91998 WP_000397562.1.92112 WP_000397562.1.92179 WP_000397562.1.9228 WP_000397562.1.9233 WP_000397562.1.92365 WP_000397562.1.92417 WP_000397562.1.92515 WP_000397562.1.92611 WP_000397562.1.92623 WP_000397562.1.92687 WP_000397562.1.92711 WP_000397562.1.92749 WP_000397562.1.92830 WP_000397562.1.92945 WP_000397562.1.92998 WP_000397562.1.9309 WP_000397562.1.93094 WP_000397562.1.93114 WP_000397562.1.93151 WP_000397562.1.9316 WP_000397562.1.93280 WP_000397562.1.93437 WP_000397562.1.93451 WP_000397562.1.93485 WP_000397562.1.93580 WP_000397562.1.93682 WP_000397562.1.93778 WP_000397562.1.93796 WP_000397562.1.93849 WP_000397562.1.93868 WP_000397562.1.93948 WP_000397562.1.93991 WP_000397562.1.94012 WP_000397562.1.94015 WP_000397562.1.94034 WP_000397562.1.94129 WP_000397562.1.94144 WP_000397562.1.94265 WP_000397562.1.94387 WP_000397562.1.94410 WP_000397562.1.94672 WP_000397562.1.9472 WP_000397562.1.94725 WP_000397562.1.94740 WP_000397562.1.94816 WP_000397562.1.94826 WP_000397562.1.94900 WP_000397562.1.94948 WP_000397562.1.95001 WP_000397562.1.95026 WP_000397562.1.95040 WP_000397562.1.95092 WP_000397562.1.95109 WP_000397562.1.95111 WP_000397562.1.95220 WP_000397562.1.95260 WP_000397562.1.95269 WP_000397562.1.95270 WP_000397562.1.9536 WP_000397562.1.95539 WP_000397562.1.95599 WP_000397562.1.95622 WP_000397562.1.95653 WP_000397562.1.95665 WP_000397562.1.95755 WP_000397562.1.95844 WP_000397562.1.95859 WP_000397562.1.95873 WP_000397562.1.95923 WP_000397562.1.9593 WP_000397562.1.96029 WP_000397562.1.96046 WP_000397562.1.96119 WP_000397562.1.962 WP_000397562.1.96323 WP_000397562.1.9645 WP_000397562.1.96518 WP_000397562.1.96556 WP_000397562.1.96598 WP_000397562.1.96696 WP_000397562.1.96741 WP_000397562.1.96747 WP_000397562.1.96942 WP_000397562.1.96966 WP_000397562.1.96998 WP_000397562.1.97032 WP_000397562.1.9714 WP_000397562.1.97163 WP_000397562.1.97180 WP_000397562.1.97300 WP_000397562.1.9733 WP_000397562.1.97404 WP_000397562.1.97520 WP_000397562.1.97709 WP_000397562.1.97710 WP_000397562.1.97780 WP_000397562.1.97844 WP_000397562.1.97893 WP_000397562.1.97920 WP_000397562.1.9794 WP_000397562.1.98004 WP_000397562.1.98007 WP_000397562.1.98068 WP_000397562.1.98150 WP_000397562.1.98224 WP_000397562.1.98272 WP_000397562.1.9832 WP_000397562.1.98354 WP_000397562.1.98434 WP_000397562.1.98523 WP_000397562.1.98561 WP_000397562.1.98595 WP_000397562.1.98625 WP_000397562.1.98666 WP_000397562.1.98691 WP_000397562.1.98692 WP_000397562.1.987 WP_000397562.1.98769 WP_000397562.1.98806 WP_000397562.1.98835 WP_000397562.1.98919 WP_000397562.1.98950 WP_000397562.1.98965 WP_000397562.1.98968 WP_000397562.1.98986 WP_000397562.1.98998 WP_000397562.1.99048 WP_000397562.1.99049 WP_000397562.1.99077 WP_000397562.1.99120 WP_000397562.1.99162 WP_000397562.1.99188 WP_000397562.1.99206 WP_000397562.1.99250 WP_000397562.1.99391 WP_000397562.1.99395 WP_000397562.1.99420 WP_000397562.1.99449 WP_000397562.1.99464 WP_000397562.1.9952 WP_000397562.1.99555 WP_000397562.1.99653 WP_000397562.1.99665 WP_000397562.1.99697 WP_000397562.1.99770 WP_000397562.1.99775 WP_000397562.1.99806 WP_000397562.1.99825 WP_000397562.1.99833 WP_000397562.1.99868 WP_000397562.1.99964 WP_000397562.1.9997 405416.ACICU_03009 480119.AB57_3179 509173.ABAYE0725 557600.ABBFA_000712 gi|384133020|ref|YP_005515632.1| gi|384144436|ref|YP_005527146.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]