SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 557723.HAPS_1654 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  557723.HAPS_1654
Domain Number 1 Region: 86-144
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000589
Family NfeD domain-like 0.0056
Further Details:      
 
Weak hits

Sequence:  557723.HAPS_1654
Domain Number - Region: 19-98
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 0.00017
Family Cation efflux protein transmembrane domain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 557723.HAPS_1654
Sequence length 146
Comment (Haemophilus parasuis SH0165)
Sequence
MEWLSGWTAWLIFGFILLILETLIAGIFIMWWGFAAIVVAILLILFPNIELGWQATIFAV
LAILFSLAWWKYQHSKDQKEDQQADLNARDHAMIGLQGTVVEVLDSGVARGKFGDTTWRV
IGNTLKVGDNIQVEKVDGITLFVRVV
Download sequence
Identical sequences B8F797
gi|219871772|ref|YP_002476147.1| 557723.HAPS_1654 WP_015939874.1.69939 WP_015939874.1.83421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]