SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 557760.RSKD131_4299 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  557760.RSKD131_4299
Domain Number 1 Region: 704-901
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.79e-23
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.022
Further Details:      
 
Domain Number 2 Region: 24-229
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.89e-17
Family Pyruvate oxidase and decarboxylase Pyr module 0.039
Further Details:      
 
Domain Number 3 Region: 425-530
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.000000000000252
Family Pyruvate oxidase and decarboxylase PP module 0.082
Further Details:      
 
Weak hits

Sequence:  557760.RSKD131_4299
Domain Number - Region: 279-363
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0243
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 557760.RSKD131_4299
Sequence length 1119
Comment (Rhodobacter sphaeroides KD131)
Sequence
MTLHTRPEAPAPALTDRYTQASGRILASGAQALARLMIEQQRRDRADGLDTAGYVTGYRG
SPLADFDGELMRAGRFLSASAIRFQPGLNEDLAATAVWGSQQIDLSPGARHDGVFALWYG
KGPGVDRSMDAIRHANAAGTHPRGGVLLLMGDDHGAVSSTFPHQSEQVLISAMVPILSPA
GVEEYIDFGLAGFALSRFAGVWVGFKCQTDIVECTRSIDLPDPAARPALPDMTLPPGGLS
IRWPDDKLAQEARLEVKMEAVRAFAAANGLDRILGAGAGARRGIVATGKAWRDLTGAFAR
AGISPEEAGLRLLKVGLVWPLVPATLDRFAEGLEEILVIEEKRPVIEDQIRAQFYNRTGA
RPRIWGKTTPEGAPLISSTAELDPAGLVPVLAAFLRLPPIPLPEAPAPAPGLPFREPYFC
SGCPHSVSTKLPDGSRATAGIGCSMLAVAMDRNVETFTQMGGEGANWIGHAPFTDERHVF
VHMGDGTYFHSGLLAIRAAVAAGVNATYKILFNDAVAMTGGQTHDGSLTVPAAVDQIRAE
GVRELVVIAEEPAQWQGRLPAGVKVLHRDRLQAEQIRLREVEGVTCIIYDQVCAAEKRRR
RKRGSHPKPAAQVMIHPGVCEGCGDCSVQSNCIAIEPLETDLGRKRQVNLSACNADLSCL
KGFCPSFVTIEGGQRRPQLAPLPEALGHDLPPPAAAPAGPAQALLLAGIGGTGVITVSAI
LAQAAHLDGLAVQVLNQTGLAQKNGAVMAHLRFATDARALHAPRIGLAEADAVLAFDSVA
AAAPKGLACIDPGRTRVVADRHVTPTAGFVRHSTAPREDMQAMDQLRSRARARLETVPAT
ELALHHFGDAIAANILLTGHAFQLGLIPLSEGAILQAIRMNGGAAERNLEAFRAGRLLAA
RPEAFAPAPPAAEPTVAELRDRLVRHLTEWQDTPYAARFERLMDRAAARVQGWTGGEAFL
RALMRGTHHVMAFKDEYEVARLHLDPSFHASVAREFEGDYRLAYHLSPPFPGRADARTGR
PAKLRFGPWMQHGFRLLARMKRLRGTPFDPFGQSSERRAERALRERYIRRMEDRIAALTP
EDLPAATQEAEAVLAVRGFGPVKARNLARWQAEWGDARA
Download sequence
Identical sequences B9KVT1
WP_015923219.1.19875 gi|221370136|ref|YP_002521232.1| 557760.RSKD131_4299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]