SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 559295.KLTH0E04796g from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  559295.KLTH0E04796g
Domain Number 1 Region: 650-874
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 5.11e-63
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.00067
Further Details:      
 
Domain Number 2 Region: 876-1036
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.01e-35
Family NADPH-cytochrome p450 reductase-like 0.0016
Further Details:      
 
Domain Number 3 Region: 370-616
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.36e-29
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0083
Further Details:      
 
Domain Number 4 Region: 237-365
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 9.81e-17
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 559295.KLTH0E04796g
Sequence length 1036
Comment (Lachancea thermotolerans CBS 6340)
Sequence
MGLEFSTNPFGIPSNWKESNAYTTPVTAISSVLAGNLESVFSYKTFSEPDLLDGALKKWS
SKGYTTLQFEELQLRSGAGLAPLGFARGSGHSSLYGIITPGYGLSYFANAFTREAETKNR
FLFNVGALEYNEESGQVASDFVTPVKIAASMGLPVVSPTSVKEVKHTALLAIALAKFGKP
IGAVNLFDGANYAKTVLNIDEQESQDIIGELSSSLVVGSTFDQILDKFNEVSSAKLHNFD
YHGDENAETVFVTFGCVESELFSTSLRGNTNNVGHIAIRIPLPFDTEKFVAQIPKSAKNL
VVIGQSLDGQSPTTLKSQISAALFFQKAKTVKVSEYLYLPSFVWSADAVKQVVSTFAPEF
SSYVSHQAENFIYWASDSSVNLDVASRLVHALSLVDNREVSFRTKFDNNANGGVFQAQFS
SGKQSGSHVFSNIDSANVAVVENLSILNAFDVAKTVDNNGVVLIITEKSIKDKDLSDSKV
LAEELKIPISFLRQAVDKNLLLAFLDTETIGDKEETKGRTASFVTQAAFWKYAYKLSVAE
SVRRIWSSAGSDIELLAAVLSETITTAFEVGLHEVPAEKLSKSIPEVSPEKDEEGPLPSL
LTETCFKPNPRKSEEHSEVELSSKASVAQQLSFKEAFATESSLRPDLPMKNFIVKVKENR
RVTPDDYDRYIFHIEFDITGTGLTYGIGEALGVHARNNQPLVREFLESYGLSENDIIQVP
SKEDHDVLESKTVLKAFTENLDLFGKPPKAFYQSLIDFASNEDEKRKLEELVSPEGAVLL
KKYQDVEYYTYADIFKLFPSARPGITDLVRIISPLKRREYSIASSQRVHPNEVHLLIVVV
DWIDNKGRKRFGQSSKYLAELPVGAELVVSVKPSVMKLPPSPQQPVIMSGLGTGLAPFKA
IVEEKFWQKQQGHDIGKVFLFLGSRHKREEYLYGELWEAYKDAGIVTHIGAAFSRDQPHK
IYIQDRIREALKELQTALIDEKGSFYLCGPTWPVPDITKALQDIIKADADERGEKVNLDE
AIEELKETSRYILEVY
Download sequence
Identical sequences C5DHJ4
XP_002553692.1.30775 gnl|GLV|KLTH0E04796g 559295.KLTH0E04796g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]