SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 561229.Dd1591_3025 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  561229.Dd1591_3025
Domain Number 1 Region: 105-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000068
Family NfeD domain-like 0.0084
Further Details:      
 
Weak hits

Sequence:  561229.Dd1591_3025
Domain Number - Region: 14-84
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 0.000458
Family Cation efflux protein transmembrane domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 561229.Dd1591_3025
Sequence length 151
Comment (Dickeya zeae Ech1591)
Sequence
MMALVWENAHWFWLSLGGLLLAAEMLGAGGYLLWSGIAALFTGILAWLLPLDWAWQCIAF
AVLTVVSALLWWQWLRRRLDKQPTPILNQRGQQLIGLHTTLTEPLINGLGRVNIGDSSWR
VQAEQDLPAGTVVEVTAVEGITLRVRPRVDA
Download sequence
Identical sequences C6CQQ3
WP_012770699.1.79317 gi|251790605|ref|YP_003005326.1| 561229.Dd1591_3025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]