SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 561230.PC1_1099 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  561230.PC1_1099
Domain Number 1 Region: 91-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000157
Family NfeD domain-like 0.0065
Further Details:      
 
Weak hits

Sequence:  561230.PC1_1099
Domain Number - Region: 29-105
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000615
Family LacY-like proton/sugar symporter 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 561230.PC1_1099
Sequence length 151
Comment (Pectobacterium carotovorum PC1)
Sequence
MGIELVMENAHWFWLSLGGLLLAAEMLGASGYLLWSGLSAVLVGLLTWVMPLGWPWQGTI
FAILTIVTALLWWYWLRKRTLSRPQSTLNQRGQQLLGLRATLTEPVTNGFGRVNIGDSSW
RVKSEQDLPAGTHVEVIAIDGITLHVRPTER
Download sequence
Identical sequences C6DBN0
561230.PC1_1099 WP_015839388.1.10570 gi|253687493|ref|YP_003016683.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]