SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 561231.Pecwa_3217 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  561231.Pecwa_3217
Domain Number 1 Region: 91-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000196
Family NfeD domain-like 0.0054
Further Details:      
 
Weak hits

Sequence:  561231.Pecwa_3217
Domain Number - Region: 29-106
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00204
Family LacY-like proton/sugar symporter 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 561231.Pecwa_3217
Sequence length 151
Comment (Pectobacterium wasabiae WPP163)
Sequence
MGIELVMENAHWFWLSLGGLLLAAEMLGASGYLLWSGVSAVLVGLLTWVMPLGWPWQGTI
FAIMTIVTALLWWYWLRKRTLSRPPSTLNQRGQQLIGLRATLTEPVTNGFGRVNIGDSSW
RVKSEQELPAGTHVEVIAVDGITLHVRSIEH
Download sequence
Identical sequences A0A0H3I5N7 D0KJ14
WP_014700797.1.14155 WP_014700797.1.36680 WP_014700797.1.70306 WP_014700797.1.77019 WP_014700797.1.78307 561231.Pecwa_3217 gi|261822460|ref|YP_003260566.1| gi|470155659|ref|YP_006284161.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]