SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 561501.BUAPTUC7_491 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  561501.BUAPTUC7_491
Domain Number 1 Region: 1-204
Classification Level Classification E-value
Superfamily Formyltransferase 6.28e-60
Family Formyltransferase 0.00000203
Further Details:      
 
Domain Number 2 Region: 207-308
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 4.87e-28
Family Post formyltransferase domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 561501.BUAPTUC7_491
Sequence length 314
Comment (Buchnera aphidicola Tuc7 Acyrthosiphon pisum )
Sequence
MKKLKIVFAGTEYFSAEHLHALITSSHDVISVITQPDRYSGRGQKITFSPVKILSLNNGI
PIFQPENLNDTDFQNKLLKLNADIMTVVSYGKIIPKKILNMFSKGCINVHASLLPRWRGA
TPIQSSILHGDKKTGISIIQMNDEIDSGNIMHSITCSISSKDTTKTLSLKLIKIGIEALL
EVLEKIILNTVIYKKQNEKNVILSKKIYKKDALLDWNLSAEKLERLIRAFNPWPICYFLS
QNKNIKVWQSEVIPITQNNRSVGEIISYNKNGIQINTSHQILNIKKLQFPGKKIIDVKNV
IISKKKLFKIGTIL
Download sequence
Identical sequences B8D822 B8D9S0 P57564
107806.BU497 561501.BUAPTUC7_491 563178.BUAP5A_490 NP_240304.1.37072 WP_009874448.1.11339 WP_009874448.1.46144 WP_009874448.1.6230 WP_009874448.1.83785 WP_009874448.1.93284 gi|219681843|ref|YP_002468229.1| gi|414562847|ref|YP_005618038.1| gi|15617091|ref|NP_240304.1| gi|384226783|ref|YP_005618534.1| gi|219682398|ref|YP_002468782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]