SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 563178.BUAP5A_096 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  563178.BUAP5A_096
Domain Number 1 Region: 97-151
Classification Level Classification E-value
Superfamily SMR domain-like 0.00000000183
Family Smr domain 0.014
Further Details:      
 
Weak hits

Sequence:  563178.BUAP5A_096
Domain Number - Region: 68-108
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.0167
Family AstE/AspA-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 563178.BUAP5A_096
Sequence length 186
Comment (Buchnera aphidicola 5A Acyrthosiphon pisum )
Sequence
MDKNSRYTVDSSILFRQWLNDTREMVQDTIFHSRIQKKNNNHPVSQRVFFEQNAHSHYFS
YRNNKNLFKENPVSYIRHQSLYNVLKNLKKGRYNPDISIDLHGLTQHQAQQALGELITTC
QKEKIFCAHIMHGHGKHILKKQTPFWLSQHPDIIAFHEAPKFFGSDAAIIVIIEINSLKK
NINIFN
Download sequence
Identical sequences B8D8Q0 P57199
gi|15616719|ref|NP_239931.1| gi|219681474|ref|YP_002467859.1| NP_239931.1.37072 WP_009874053.1.11339 WP_009874053.1.46144 WP_009874053.1.6230 gi|414562459|ref|YP_005617650.1| 107806.BU098 563178.BUAP5A_096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]