SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 565034.BHWA1_00203 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  565034.BHWA1_00203
Domain Number 1 Region: 85-355
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.04e-93
Family RecA protein-like (ATPase-domain) 0.00000000425
Further Details:      
 
Domain Number 2 Region: 353-468
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 1.94e-50
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00000911
Further Details:      
 
Domain Number 3 Region: 6-81
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 1.36e-21
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 565034.BHWA1_00203
Sequence length 470
Comment (Brachyspira hyodysenteriae WA1)
Sequence
MVEGKRGKVIQVVGSTLDAEFEEGHLPAILNALYIDKEIEGVQRHIICEVQQHLGGGRVR
AIALESTDGISRGDDIFDTGNHIMVPVGTETIGRIFNVLGQTVDKGEPIVAKEYRSIHAS
PPKFENLEPKLEIFETGIKVIDLLAPYIKGGKTGLFGGAGVGKTVLIMELIHNIASEHGG
YSVFAGVGERTREGNDLWSEMKESGVINKTCLVYGQMNEPPGARLRVALSALTMAEYFRD
SAGLDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTKNGSIT
SIQAVYVPADDLTDPAPATAFTHLDATTVLSREVSEKGIYPAVDPLASTSRILDPNILGQ
EHYDVARKVQHILQRYRDLQDIIAILGADELSEDDKLIVSRARKIEQFLSQPFFVGEQFT
GLQGRYVKLEDTIRSFKGICNGDYDDLPDQAFRFVGSIEEAVAKAKTVSN
Download sequence
Identical sequences A0A193F676 C0QX45
gi|225619150|ref|YP_002720376.1| WP_012669756.1.100804 WP_012669756.1.11734 WP_012669756.1.24451 WP_012669756.1.28499 WP_012669756.1.37874 WP_012669756.1.38209 WP_012669756.1.44798 WP_012669756.1.45318 WP_012669756.1.54887 WP_012669756.1.54899 WP_012669756.1.64247 WP_012669756.1.64884 WP_012669756.1.67878 WP_012669756.1.68144 WP_012669756.1.68422 WP_012669756.1.68614 WP_012669756.1.75576 WP_012669756.1.85211 WP_012669756.1.88305 WP_012669756.1.89179 WP_012669756.1.95116 WP_012669756.1.95541 WP_012669756.1.9677 565034.BHWA1_00203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]