SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 565034.BHWA1_01763 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  565034.BHWA1_01763
Domain Number 1 Region: 7-203
Classification Level Classification E-value
Superfamily ClpP/crotonase 6.01e-23
Family Clp protease, ClpP subunit 0.084
Further Details:      
 
Domain Number 2 Region: 381-442
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000107
Family NfeD domain-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 565034.BHWA1_01763
Sequence length 444
Comment (Brachyspira hyodysenteriae WA1)
Sequence
MKKFNNILIIFFLSIFIFSNYLYSKDSKVYVIKKQEFQEIDRWYAGYIKNSIDEANDKKA
DLIILELDTPGGLLSSALSIKNYIMESNVPVVVYINKNALSAGALISLSAKEIYMSDGSV
IGAATPVYLNGNEPKKAGEKEVSAMRAAMRSSAETTKKNAKAAEAMVDETIILTKKSDGI
DLDDKTLLTLSADEAVSINIADKKANSINEILELKNIENAEIINIEEDVYDSVLKFLLNP
FVLSILMSIGIAGIYLEIKTPGFGVGGVTAIIAFAVFFFVQFFSGSSTFLAPAIFLLGII
LLCVEIFLIPGFGITGILGIIGIASGIFISFGIHNIAVASFVIFISLLIDIILVILIARF
MSKSKDFKDKIMLDSDTSGYHSSVSYDDLIGKDGIAETFFRPSGYIVIDGQKYDAVSEGE
FIDKGSSLKVILVEGNRIVVKKSS
Download sequence
Identical sequences C0R290
gi|225620674|ref|YP_002721932.1| WP_012671268.1.28499 WP_012671268.1.45318 WP_012671268.1.67878 565034.BHWA1_01763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]