SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 565050.CCNA_02632 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  565050.CCNA_02632
Domain Number 1 Region: 20-206
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 7.32e-50
Family SOUL heme-binding protein 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 565050.CCNA_02632
Sequence length 208
Comment (Caulobacter crescentus NA1000)
Sequence
MSMTLRRMAMTAVFAAVFLGTVAMAVEEPVFKVVLHEGDFDVRDYPALVVAEVTVSGDQK
QAANRGFRLLAGYIFGGNRTRQSIAMTAPVAQAPAGQTIAMTAPVTQTQSAGQWVVRFTM
PSRYSLEALPEPNDPQVKLRLIPPSRLAVLRFSGLAGADTVEVKTADLKKRLSAHQLQAT
GPATLAQYNTPWTPWFMRRNEVMIPVAP
Download sequence
Identical sequences A0A0H3C9K4 Q9A5A3
gi|16126788|ref|NP_421352.1| 190650.CC_2549 565050.CCNA_02632 NP_421352.1.61804 YP_002518005.1.80956 gi|221235568|ref|YP_002518005.1| CcR31

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]