SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 565050.CCNA_03484 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  565050.CCNA_03484
Domain Number 1 Region: 92-153
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000549
Family NfeD domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 565050.CCNA_03484
Sequence length 154
Comment (Caulobacter crescentus NA1000)
Sequence
MMDAIAGFHALHPFWLWLAVAAAFLAVEVATGTGWLLWPAASAFVVGVIAQLLPTSFVIE
LGLFAALAIASTYLAKRFLRPVLEASGPDLNDPMQRLIGQRGQVLSTFEQGRGRVFIDGK
DWAAETDEPIPAISQEVVVVGVDGAILKVRKIPT
Download sequence
Identical sequences A0A0H3CD70 Q9A332
gi|221236420|ref|YP_002518857.1| NP_422168.1.61804 YP_002518857.1.80956 190650.CC_3374 565050.CCNA_03484 gi|16127604|ref|NP_422168.1| GO.2519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]