SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 56780.SYN_00693 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  56780.SYN_00693
Domain Number 1 Region: 1-174
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.01e-39
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 56780.SYN_00693
Sequence length 175
Comment (Syntrophus aciditrophicus SB)
Sequence
MLEIRIHSRGGQGGVTGARLLALAAIHDGKYATASVFYGPQRRGAPVMSFVRIDDRPIRI
YSRIKEPDMVVILDASVMDMVNVLQGLKQGGRIFINSVEAKDFPGFSTCHADLTGIAQKE
NIIVAGYTILNTPMLGCLAKMGIISLDSARKSILEMFPDECNVRAAEAGYREMKL
Download sequence
Identical sequences A0A1V4XYU7 Q2LV76
WP_011418009.1.90099 gi|85859954|ref|YP_462156.1| 56780.SYN_00693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]