SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 56780.SYN_02179 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  56780.SYN_02179
Domain Number 1 Region: 40-203
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.29e-23
Family Crotonase-like 0.036
Further Details:      
 
Domain Number 2 Region: 375-439
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000000615
Family NfeD domain-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 56780.SYN_02179
Sequence length 440
Comment (Syntrophus aciditrophicus SB)
Sequence
MENRMKRLRQIFAFLSGLLIFFMLLGICFAAHDEEKKPVFDVIRINAAITPPVADYILQS
LDAAGKAGADGLIILLDTPGGLDLAMRDIVKGILGARIPVIVYVSPSGARAASAGMIITI
AAHVAAMAPGTNIGAAHPVGIGIGGGSDKVMMEKVENDAVAYAVSIARQKGRNVEWVEKA
VRKSESIPADEARQTRVVDWVAGDLNALLEMMNDQEVQIQGGVKIIKTKGGILRDRKMNL
RQKVLTTLSDPNIAYILLLVGLAGLYFEFAHPGVILPGVIGGISLIMSFFALQTLPVNYA
GIALILFGLILFIAEIKVISHGLLSLGGVISLFLGSLLLFDSPEPALRVALKVMIPALII
TSSFFIFIVSLVIKAQVRKKHTGIDELIDAEGIALTDIHESGKTFIRGEYWDSWSEHPIE
KGEKVRVERVEGMKIKVTKK
Download sequence
Identical sequences Q2LTM1
56780.SYN_02179 gi|85859397|ref|YP_461599.1| WP_011417453.1.90099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]