SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 56780.SYN_02201 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  56780.SYN_02201
Domain Number 1 Region: 785-1170
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.24e-127
Family PFOR PP module 0.00000000304
Further Details:      
 
Domain Number 2 Region: 416-666
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.48e-82
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0000000531
Further Details:      
 
Domain Number 3 Region: 6-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.12e-70
Family PFOR Pyr module 0.0000000228
Further Details:      
 
Domain Number 4 Region: 259-413
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.02e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000949
Further Details:      
 
Domain Number 5 Region: 669-759
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.56e-18
Family Ferredoxin domains from multidomain proteins 0.0000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 56780.SYN_02201
Sequence length 1172
Comment (Syntrophus aciditrophicus SB)
Sequence
MAGYNKTLEGNEIAAHVAYAMSEVAAIYPITPSSTIGEYCSEWAARGKKNIFGQVLDLIE
MQSEAGAAAAVHGALAAGTLATTFTASQGLLLMKPDMYKIAGELMPAVFHIAARSVAGHA
LCIFGDHSDINAVRQTGFCQLASASPQEVMDLGLVSHLASIKASLPFIHCFDGFRTSMVI
QKVELINYTDMAKLVDWYAIERFRARSMNPEHPQMRGTSQISDIYFQNREACSPYYARVP
AIVEEEMKKVGELTGRPYHLFDYVGHPEADKIIVSMGSSCDVIEGTIDYLNARGARLGLI
KVRLYLPFSREHFFKVLPRSAKKIAVLDRVKTPLTIGEPLYQDVSTAINEGGFGQMVVGG
RYGLGSKDFTPAMVKAVYDNLEQWEPKRSFTVGINDDVSNSSLEVGEEFSASPPGTSSCK
FWGIGADGTVGANKEAIKIIGENTDLYTQAYFAYDAKKSGGVTVSHVRFSPNRILSHYLI
KHADLIACHVPAYVHQFDLLEGIVDGGIFLLNSPWTVEQMETELPSSLRRIIAEKHLKFY
NIDAVTIADRVGLGGRINMIMQAAFFKIANVIPPDEAINFLKDAIRKTYGKKGDKIVNMN
IAAVDKALDAIKVIEVPEAWAKSARSEYAYENVSEFVTKVMNPMILQKGDQVPVSALPPD
GIFPTATSQYEKRGVAIHVPEWIPENCIQCNQCSFVCPHASIRPVLVTEEELKEAPDYFT
TLEAQGKELKGLRFRIQVSPLDCVGCGNCADICPSKEKALVMRYLCSQDDKQIPNHKFSL
TVPVRDNLMSKTTVKGSQFCQPLFEFSGACPGCGETPYIKVITQLFGDRMIIGNATGCSS
IYGGSAPVCPYTVNPKGHGPAWANSLFEDNAEFTLGVEMGVAKRRDKLASFMRDAIQQGI
SEGLKNLFEAWLAGMNDPGKTKELRDQIEEALSNEILKSVGPQKDNLINILKLKDMIVKK
SIWAIGGDGWAYDIGYGGLDHVMAQNHDLNILVLDTEVYSNTGGQASKSTPTGAVAKFAA
KGKPIGKKDLGRMAMVYRYVYVASVAMGASKTQFLKAVTEAESYPGTSLIIAYSPCINHG
IDMGKSQEEEKRAVEAGYWPLYRYNPLLAAEGKNPFQLDSGEIKGDFQEFINGEVRYSSL
KRMFPDVADKLYKLAEEEAKERIAIYKKLAGK
Download sequence
Identical sequences Q2LYH6
WP_011416020.1.90099 gi|85857951|ref|YP_460153.1| 56780.SYN_02201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]