SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 568206.BAMEG_2517 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  568206.BAMEG_2517
Domain Number 1 Region: 79-139
Classification Level Classification E-value
Superfamily NfeD domain-like 1.7e-16
Family NfeD domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 568206.BAMEG_2517
Sequence length 142
Comment (Bacillus anthracis CDC 684)
Sequence
MAAWVIWFIIAGILFIAEMLSITFYMLWLGIGAVVGGLIALFAPEALLLQVVAGAIVSLT
LTFFTKRISKNFREAKGFTDTVDMLVGKKGIVMQAITKETNGIVKVDGDTWTAVADAPID
TGEKVVVIKRNSTILQVKKESE
Download sequence
Identical sequences Q81RH2
gi|49184938|ref|YP_028190.1| gi|47527366|ref|YP_018715.1| NP_844474.1.87267 WP_000741982.1.100214 WP_000741982.1.100595 WP_000741982.1.10208 WP_000741982.1.11427 WP_000741982.1.11676 WP_000741982.1.13115 WP_000741982.1.13233 WP_000741982.1.13820 WP_000741982.1.14721 WP_000741982.1.14855 WP_000741982.1.15460 WP_000741982.1.15569 WP_000741982.1.16170 WP_000741982.1.16997 WP_000741982.1.17146 WP_000741982.1.18976 WP_000741982.1.19258 WP_000741982.1.19435 WP_000741982.1.19445 WP_000741982.1.20390 WP_000741982.1.20680 WP_000741982.1.21021 WP_000741982.1.21258 WP_000741982.1.21776 WP_000741982.1.22865 WP_000741982.1.23269 WP_000741982.1.2419 WP_000741982.1.24334 WP_000741982.1.24556 WP_000741982.1.24608 WP_000741982.1.25716 WP_000741982.1.25752 WP_000741982.1.2618 WP_000741982.1.26665 WP_000741982.1.26721 WP_000741982.1.27644 WP_000741982.1.27987 WP_000741982.1.28427 WP_000741982.1.28729 WP_000741982.1.29101 WP_000741982.1.29787 WP_000741982.1.30110 WP_000741982.1.31490 WP_000741982.1.3236 WP_000741982.1.32576 WP_000741982.1.33175 WP_000741982.1.33338 WP_000741982.1.33367 WP_000741982.1.33740 WP_000741982.1.33876 WP_000741982.1.34646 WP_000741982.1.35684 WP_000741982.1.35886 WP_000741982.1.36305 WP_000741982.1.36763 WP_000741982.1.38036 WP_000741982.1.39781 WP_000741982.1.40550 WP_000741982.1.41165 WP_000741982.1.41675 WP_000741982.1.4439 WP_000741982.1.45305 WP_000741982.1.45533 WP_000741982.1.46236 WP_000741982.1.46699 WP_000741982.1.47145 WP_000741982.1.4763 WP_000741982.1.47644 WP_000741982.1.47798 WP_000741982.1.51749 WP_000741982.1.52794 WP_000741982.1.53137 WP_000741982.1.53493 WP_000741982.1.53683 WP_000741982.1.54117 WP_000741982.1.54189 WP_000741982.1.55811 WP_000741982.1.55958 WP_000741982.1.56042 WP_000741982.1.56176 WP_000741982.1.56270 WP_000741982.1.56959 WP_000741982.1.58160 WP_000741982.1.59095 WP_000741982.1.59310 WP_000741982.1.59575 WP_000741982.1.60402 WP_000741982.1.61213 WP_000741982.1.63560 WP_000741982.1.68607 WP_000741982.1.69203 WP_000741982.1.69822 WP_000741982.1.69894 WP_000741982.1.70065 WP_000741982.1.70996 WP_000741982.1.72704 WP_000741982.1.73325 WP_000741982.1.74226 WP_000741982.1.74538 WP_000741982.1.75499 WP_000741982.1.75870 WP_000741982.1.76125 WP_000741982.1.76783 WP_000741982.1.77668 WP_000741982.1.77824 WP_000741982.1.78644 WP_000741982.1.79315 WP_000741982.1.79584 WP_000741982.1.80439 WP_000741982.1.80695 WP_000741982.1.81799 WP_000741982.1.82289 WP_000741982.1.83951 WP_000741982.1.84045 WP_000741982.1.85689 WP_000741982.1.86119 WP_000741982.1.86140 WP_000741982.1.86239 WP_000741982.1.86288 WP_000741982.1.8698 WP_000741982.1.8825 WP_000741982.1.88641 WP_000741982.1.90791 WP_000741982.1.90883 WP_000741982.1.9186 WP_000741982.1.92686 WP_000741982.1.92831 WP_000741982.1.93271 WP_000741982.1.93744 WP_000741982.1.93927 WP_000741982.1.94237 WP_000741982.1.94322 WP_000741982.1.94784 WP_000741982.1.96934 WP_000741982.1.97781 WP_000741982.1.97861 WP_000741982.1.98216 WP_000741982.1.99445 WP_000741982.1.99485 WP_000741982.1.99994 YP_028190.1.16718 gi|386735841|ref|YP_006209022.1| gi|229600376|ref|YP_002866458.1| gi|30262097|ref|NP_844474.1| 198094.BA_2074 260799.BAS1927 261594.GBAA2074 568206.BAMEG_2517 592021.BAA_2140 gi|227815106|ref|YP_002815115.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]