SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5722.A2DNY7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5722.A2DNY7
Domain Number 1 Region: 4-101
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000111
Family Calponin-homology domain, CH-domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5722.A2DNY7
Sequence length 188
Comment (Trichomonas vaginalis)
Sequence
MQEFQLEELLKWIDGIPLSRKKKNLSRDFSDGVLMAEICAHFYPKAVDLFNYNEGLKVDT
KIYNWNTLNAKVLQKIKFPIDKATITDIANCKQGTIEKVLWDFKQFVENKQEEAQKPYFE
DVQTDPDIEEIENALKATDRTLLENKIKECEDQAKYIEELHAKIKKVEDLIKEKDLTLSQ
LKSSVFRR
Download sequence
Identical sequences A2DNY7
XP_001329971.1.43485 gi|121913022|gb|EAY17836.1| gi|123509902|ref|XP_001329971.1| 5722.A2DNY7 80596.m00170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]