SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5722.Q27089 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5722.Q27089
Domain Number 1 Region: 777-1154
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.25e-104
Family PFOR PP module 0.000000037
Further Details:      
 
Domain Number 2 Region: 413-654
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.18e-68
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000202
Further Details:      
 
Domain Number 3 Region: 7-261
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.53e-64
Family PFOR Pyr module 0.000000161
Further Details:      
 
Domain Number 4 Region: 262-403
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.19e-29
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000672
Further Details:      
 
Domain Number 5 Region: 659-761
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.26e-19
Family Ferredoxin domains from multidomain proteins 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5722.Q27089
Sequence length 1157
Comment (Trichomonas vaginalis)
Sequence
MLRNFSKRVPGDGNTAATSVAYQLTETSFIYPITPATTMGELVDAWIAQGRKNIWGNKVN
MAMMQSEGGAAAAVHGATAVGALCATFTASQGALLMIPDMYKIVGEMCPAVFHIAARCIA
TSALSIYNDHGDIYACRATGMPILFSNGVQEAHDLAAVAHLTSIHTGLPFIHTFDGFRTS
HEINTYEELDNETLWPLIDQKALAAFRARSLNPEHPSERGTICGPEYVWQMHEKLRKPYQ
ALPAEVEKMMKALGDKTGRYYKPYQYAGPRDPENVIIMMGSGCDPVEEFITEHPEYKTGL
IKVYLYRPFSVEMFNAAIPSSVKRVCVLDKVVDPTGPREPLFEDVAAAIIGQRNVKIIGG
RYGISSRDFAPVHVEAIVKNLVSQIPKDRFTVGVVNPETALPLGKPFDHLPEGTKQCMFW
GLGSDGTVGANKQAIKLIVSNTKLYGQAYFAYDAHKSGGVTTSHLRFGAKPINAPYYVQN
ADYIACHNPSYLHKFDMTKQLKQGGVFVINFPGNLDLNKDLPGSFRRSIAEKDAKLYTID
ATQIAIDLKLPGRINMLMQTVFFGLANIIPAEECIALLKKSIAKQYARKGKEVIQKNWDM
VDHALQGLKEFKYNKAEWLNAPVEPRPKHEGIRHIIDMSILQEGESVSVDEMVDIGLVPN
GTAKFEKRGIAVTVPKWDEKKCIQCNTCAMVCPHAVICPFLLKPEEVQGLTTLKAKGKEI
KDYQFRIQITPLDCTGCGTCVTSCPTKALSMTYRNAKLDEEEGKNWERLTAIPNRGHLVP
ATNVRNVQFRQPLIEFNGACQGCGETAICKLLTQLYGDQLYLANATGCSLVWGATFPFNP
YTTNERGHGPAWANSLFEDNAEFGYGMFKAVEARRNITKRLIVDVIESGEVKGELKDLFE
QLLKVWDQDKESGDLAEKIKPLLAKVQNPSEKLFDLKSQADILAKKQVWIVGGDGWAYDI
GYGGLDHVLASGENVKIIIYDTEVYSNTGGQCSKATSRGAVANFSAAGYTKAKKDLGAIA
MTYKNIYVASTCLLADPNQALKALQEAKEYNGPAIIINYSPCINHGIKKGLGSTPKHCKD
LLKTGYLNLFRYNPSKDKPLTVDTKQPDYNLDPLVKGENRFAALKDIYPKEAETKFPLLI
NDMKTRYEGYKKIQQTQ
Download sequence
Identical sequences Q27089
5722.Q27089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]