SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 572264.BCA_2144 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  572264.BCA_2144
Domain Number 1 Region: 79-139
Classification Level Classification E-value
Superfamily NfeD domain-like 1.11e-16
Family NfeD domain-like 0.0028
Further Details:      
 
Weak hits

Sequence:  572264.BCA_2144
Domain Number - Region: 10-60
Classification Level Classification E-value
Superfamily Clc chloride channel 0.017
Family Clc chloride channel 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 572264.BCA_2144
Sequence length 142
Comment (Bacillus cereus 03BB102)
Sequence
MAAWVIWFIIAGILFIAEMLSITFYMLWLGIGAVVGGLIALFVPEALLLQVVAGAIVSLT
LTFFTKRISKNFREAKGFTDTVDMLVGKKGIVMQAITNETNGIVKVDGDTWTAVADAPID
TGEKVVVIKRNSTILQVKKESE
Download sequence
Identical sequences A0A0G8E0X0 A0A154B414 A0A158RTC7 A0A1J9VNL7 A0A243BFW0 B3ZSF6 C2NGQ1 C2VST3 D8GV91
gi|301053615|ref|YP_003791826.1| gi|376265955|ref|YP_005118667.1| 572264.BCA_2144 gi|225864040|ref|YP_002749418.1| WP_000741993.1.101931 WP_000741993.1.11387 WP_000741993.1.12289 WP_000741993.1.13221 WP_000741993.1.14882 WP_000741993.1.20665 WP_000741993.1.20865 WP_000741993.1.23873 WP_000741993.1.24676 WP_000741993.1.25316 WP_000741993.1.2569 WP_000741993.1.26000 WP_000741993.1.33828 WP_000741993.1.3699 WP_000741993.1.44483 WP_000741993.1.46476 WP_000741993.1.4649 WP_000741993.1.49831 WP_000741993.1.51167 WP_000741993.1.59978 WP_000741993.1.62300 WP_000741993.1.66357 WP_000741993.1.69323 WP_000741993.1.71895 WP_000741993.1.782 WP_000741993.1.9269 WP_000741993.1.95308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]