SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 572265.HDEF_2081 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  572265.HDEF_2081
Domain Number 1 Region: 97-172
Classification Level Classification E-value
Superfamily SMR domain-like 0.00000000115
Family Smr domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 572265.HDEF_2081
Sequence length 173
Comment (Candidatus Hamiltonella defensa 5AT Acyrthosiphon pisum )
Sequence
MKNRSLLTKQESILFRKSIKGTKKLHQDTVFHSHFERSKINETKAIRFRQEQMNTISYFS
DQCPVFWKEGEPVEYIQPDIELNEISKLMKEDYLPDILLDLHGLTQRQAKEALGSLIAYK
RQKIECVNVIHGYGRNILKKNTPLWLMQHPKVLAFHQAPRRWGGSAALLVLIK
Download sequence
Identical sequences A0A2D3SYZ4 C4K7V4
WP_015874392.1.27657 572265.HDEF_2081 gi|238899113|ref|YP_002924795.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]