SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 573064.Mefer_0269 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  573064.Mefer_0269
Domain Number - Region: 6-56
Classification Level Classification E-value
Superfamily FdhE-like 0.00068
Family FdhE-like 0.022
Further Details:      
 
Domain Number - Region: 129-159
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 0.0103
Family TRADD, N-terminal domain 0.016
Further Details:      
 
Domain Number - Region: 337-364
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0484
Family NfeD domain-like 0.013
Further Details:      
 
Domain Number - Region: 229-300
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0785
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 573064.Mefer_0269
Sequence length 367
Comment (Methanocaldococcus fervens AG86)
Sequence
MKIRGICYRCGAEDELIDGLCPVCYAQEHPLIEVPDRVEVEVCHMCGSYKRKIWQTPKSE
EAFEILNEIAYYATKDAIKKKSVMVDVEIYPKITQLPGGKRSKLIIPVHIIAKGRLPGEK
EDRVYEKDIEVHLKMVQCPRCSRFMSNYYEATLQVRAMNRYLTEEEREEIDNFVREELAK
RLKKDRMAFVSKFIPQKEGLDYQLGSVGAARNVAQKIKERYGGKITETATLVGVDRDSGK
ELYRVTVSVRIPEYKVGDVVEYKDKYYLVTAITENKVYMKSIDHNREKIGLPWHVAEKET
RMEKKKDELDTATVIATTPNIMVMDDKSYEVYEFDNVGDVEVKEGDKVKIFKKEGVSYLV
NKVEEDK
Download sequence
Identical sequences C7P6C4
gi|256810237|ref|YP_003127606.1| 573064.Mefer_0269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]