SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 573064.Mefer_0801 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  573064.Mefer_0801
Domain Number 1 Region: 5-88
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000204
Family CAP C-terminal domain-like 0.074
Further Details:      
 
Weak hits

Sequence:  573064.Mefer_0801
Domain Number - Region: 92-114
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0327
Family NfeD domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 573064.Mefer_0801
Sequence length 260
Comment (Methanocaldococcus fervens AG86)
Sequence
MKKRNITEFQVLSEIIRKQPHIKQKEIAENLGITVQAVSEHIRNLVKEGYVKSRGRGEYV
VTEKGLRKLKNWISEFKDYLDEINSAVYRYKDIWPAIADDDIEDGDTVYLFMKNALLYAS
KEPKGEAKAKALYGGKKGDDIAICEIKGIVDVPKGRVVVFKIPPEVVGGSRVVDFDLIKD
NIKDLDNYVIATMGTVAYVVANKLGFKPDIRFAVPEAIVSACNRGCNVVALITGKMAEKV
IKKLDNAKISYTVLDATKNK
Download sequence
Identical sequences C7P7T7
WP_015791356.1.34365 573064.Mefer_0801 gi|256810750|ref|YP_003128119.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]