SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 573064.Mefer_0886 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  573064.Mefer_0886
Domain Number 1 Region: 1-175
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.57e-54
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 573064.Mefer_0886
Sequence length 178
Comment (Methanocaldococcus fervens AG86)
Sequence
MIEIRFHGRGGQGAVTAAQILAKAAFYDGKFCQAFPFFGVERRGAPVMAFTRIDDKKITL
RSQIYNPDYVIVQDATLLESVNVVEGLKKEGAVVINTVKDDLDLGFKTYIIDATGIALDV
LGVPIVNTAMVGAFAGVTKLVTLDSVKKAIMDTFKGKLGEKNAKAAEVAYNEMIKKYG
Download sequence
Identical sequences C7P822
WP_015791441.1.34365 573064.Mefer_0886 gi|256810835|ref|YP_003128204.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]