SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 573064.Mefer_0917 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  573064.Mefer_0917
Domain Number 1 Region: 74-136
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000000222
Family NfeD domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 573064.Mefer_0917
Sequence length 138
Comment (Methanocaldococcus fervens AG86)
Sequence
MEIGYAFILAGFLIMALEAVIPGLYFPVLGVALLIYGIFLLIFPQYAFISAIIAGVLTII
ILHKFVYSMGKEIKVGAERFVGKIAKAIEDFDENGYGRVEIENQIWLAKSKDEIKNGDKV
KVIGFEGVSLIVKKVEGE
Download sequence
Identical sequences C7P853
573064.Mefer_0917 WP_015791472.1.34365 gi|256810866|ref|YP_003128235.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]