SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 573235.ECO26_0273 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  573235.ECO26_0273
Domain Number - Region: 152-184
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0837
Family NfeD domain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 573235.ECO26_0273
Sequence length 246
Comment (Escherichia coli O26 H11 11368)
Sequence
MSDATLTRLIRPTKAHNSLYLNRQNVKNYLWLVALLPLLSGCESQAILVKKDDAYFAPPK
TEAPPPADGRAGGVFETGYNWSLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKSNTV
DIGAPTIFSHTKDKLSGSIDANRDFDGSATSQQQNSLRGEITVSVHAVQPNGILEIRGEK
WLTLNQGDEYIRLSGLVRADDIQNDNSVSSQRIADACISYAGRGALSDANAAGWLTRLFN
HPLFPI
Download sequence
Identical sequences A0A1D7PRY6
gi|260853469|ref|YP_003227360.1| 573235.ECO26_0273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]