SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 573370.DMR_07360 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  573370.DMR_07360
Domain Number 1 Region: 5-180
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.7e-41
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 573370.DMR_07360
Sequence length 182
Comment (Desulfovibrio magneticus RS 1)
Sequence
MSLYQDVIIAGFGGQGVMLIGNLLAYAGMEHGLNVTYIPVYGPEMRGGTANCTVVVSDDA
IGSPIIRSPKSLIIMNRPSLDKFQPQLVDGGVLVVNSSLVDPALADASRVRLVPVACNEI
ADGLGNTRMANMVALGAFIEATGVLPLSVVEESLSHVIAKHYSHLIPKNAEALRAGAEAA
KG
Download sequence
Identical sequences C4XJ63
gi|239905374|ref|YP_002952113.1| 573370.DMR_07360 WP_012750302.1.87776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]