SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 573370.DMR_35280 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  573370.DMR_35280
Domain Number - Region: 39-62
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 0.0405
Family Anaphylotoxins (complement system) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 573370.DMR_35280
Sequence length 227
Comment (Desulfovibrio magneticus RS 1)
Sequence
MIRVLAMADATADTPAARRAKRRFLARRRCLRALRRTLAFIVVVTPFCYFGFLLCCHMPP
EWQRGLPDLILLYEWWMFFRNAFTLLRNIWFTPLLAVLPLLVNLVFIVAYPPGQAWKIRR
DTYFNQFLPDRLAVIKHIENGDFPGFTPREGNVALPEAYAHTSLPFGRVSYTRGDNGYTI
FFYTSWNVLEAYQGFAFNKEYSKDHSPPQEAYKYMEFMTPQWYYIEY
Download sequence
Identical sequences C4XL78
573370.DMR_35280 gi|239908164|ref|YP_002954905.1| WP_015862164.1.87776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]