SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 575788.VS_1973 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  575788.VS_1973
Domain Number 1 Region: 3-129,163-222
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.55e-29
Family Clp protease, ClpP subunit 0.039
Further Details:      
 
Domain Number 2 Region: 395-459
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000144
Family NfeD domain-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 575788.VS_1973
Sequence length 468
Comment (Vibrio splendidus LGP32)
Sequence
MTFILKYLFAFLLLFSSVFAQADDVWVIEVNGGIGPATSDYLTREIEQAHDEQAKLIILK
MNTPGGLDSSMRDIIRSITTSPIPVATWVGPAGSRAASAGTYILLASHVASMAPGTNLGA
ATPVSLVGGKTPTNPLSPQDEANKDDNTSASEQDATKQENSDQVKATTAMEKKVINDAAA
YIVSLAKLHNRNEEWAEKAVREAASLDSENALTLNVIDFIASDLQQLVELSNGRTITING
VSQEVQLSDVAFVEREQDWRFSLLSVITNPNVAYILMLIGIYGLLLEFYNPGVGLPGVLG
GICLLLAMYSLQMLPVSYAGLALILLGIALMVAEAFSPSFGIFGLGGVAAFTLGSIMLMD
TEVPGYQIALPLIIGISLFSVAFIVVTISMLVRVRNKPVTTGMEAVVGDTGKVVSGFPGT
GRVLVEGEIWQAKCASELQAGQLIRVTKLTGLLLDVEALPDETSSKSS
Download sequence
Identical sequences B7VGV0
WP_012604344.1.409 gi|218709954|ref|YP_002417575.1| 575788.VS_1973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]