SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 575788.VS_2282 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  575788.VS_2282
Domain Number 1 Region: 88-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000017
Family NfeD domain-like 0.0063
Further Details:      
 
Weak hits

Sequence:  575788.VS_2282
Domain Number - Region: 29-80
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00115
Family Glycerol-3-phosphate transporter 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 575788.VS_2282
Sequence length 151
Comment (Vibrio splendidus LGP32)
Sequence
MVELLEQVNYWHWLAFGLALLALELIGTAGYFLWIGISAMLVGALLGALPIGWQMQWLSF
ASFSLITTWLWWRRQLSSDKQSDSTRDLNQREKQLIGRKTRLLEPVQKGNCRIKLGDSSW
SAMSTHDIDAGEEVVITAVDGIVLTISPTKQ
Download sequence
Identical sequences A0A1C3IRD6 A0A1E5ELQ9 B7VIJ9
WP_009847355.1.30411 WP_009847355.1.40033 WP_009847355.1.409 WP_009847355.1.99591 575788.VS_2282 gi|218710249|ref|YP_002417870.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]