SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 575788.VS_3050 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  575788.VS_3050
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.36e-37
Family Frataxin-like 0.000053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 575788.VS_3050
Sequence length 104
Comment (Vibrio splendidus LGP32)
Sequence
MNETEFHKLVDIQMQNIEEAIDESEADIDYEVTGNVMTLEFENRSQIIINRQEPMREIWL
ASKSGGFHFKLVDDKWTCSKTGMALFEMVKEECEKHADEEINWV
Download sequence
Identical sequences A0A1C3J033 A0A1E5EAJ0 A0A1E5EN58 B7VMD7
gi|218710947|ref|YP_002418568.1| WP_009848207.1.19735 WP_009848207.1.30411 WP_009848207.1.40033 WP_009848207.1.409 WP_009848207.1.49583 WP_009848207.1.5329 WP_009848207.1.99591 575788.VS_3050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]